DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Analyses of Mlc-IIBGlc interaction and a plausible molecular mechanism of Mlc inactivation by membrane sequestration. Analyses of Mlc-IIBGlc interaction and a plausible molecular mechanism of Mlc inactivation by membrane sequestration. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Nam TW., Jung HI., An YJ., Park YH., Lee SH., Seok YJ., Cha SS. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Nam TW., Jung HI., An YJ., Park YH., Lee SH., Seok YJ., Cha SS. DIP original experiment: DIP-68512X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Analyses of Mlc-IIBGlc interaction and a plausible molecular mechanism of Mlc inactivation by membrane sequestration. Analyses of Mlc-IIBGlc interaction and a plausible molecular mechanism of Mlc inactivation by membrane sequestration. Analyses of Mlc-IIBGlc interaction and a plausible molecular mechanism of Mlc inactivation by membrane sequestration. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Nam TW., Jung HI., An YJ., Park YH., Lee SH., Seok YJ., Cha SS. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Nam TW., Jung HI., An YJ., Park YH., Lee SH., Seok YJ., Cha SS. DIP original experiment: DIP-68511X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Analyses of Mlc-IIBGlc interaction and a plausible molecular mechanism of Mlc inactivation by membrane sequestration. Analyses of Mlc-IIBGlc interaction and a plausible molecular mechanism of Mlc inactivation by membrane sequestration. Analyses of Mlc-IIBGlc interaction and a plausible molecular mechanism of Mlc inactivation by membrane sequestration. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Nam TW., Jung HI., An YJ., Park YH., Lee SH., Seok YJ., Cha SS. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Nam TW., Jung HI., An YJ., Park YH., Lee SH., Seok YJ., Cha SS. DIP original experiment: DIP-68513X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Analyses of Mlc-IIBGlc interaction and a plausible molecular mechanism of Mlc inactivation by membrane sequestration. Analyses of Mlc-IIBGlc interaction and a plausible molecular mechanism of Mlc inactivation by membrane sequestration. Analyses of Mlc-IIBGlc interaction and a plausible molecular mechanism of Mlc inactivation by membrane sequestration. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Nam TW., Jung HI., An YJ., Park YH., Lee SH., Seok YJ., Cha SS. Only protein-protein interactions in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa predetermined predetermined participant predetermined Nam TW., Jung HI., An YJ., Park YH., Lee SH., Seok YJ., Cha SS. DIP original experiment: DIP-68514X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Analyses of Mlc-IIBGlc interaction and a plausible molecular mechanism of Mlc inactivation by membrane sequestration. mlc_ecoli Protein mlc Making large colonies protein mlc b1594 JW1586 protein protein ecoli Escherichia coli (strain K12) MVAENQPGHIDQIKQTNAGAVYRLIDQLGPVSRIDLSRLAQLAPASITKIVREMLEAHLVQELEIKEAGNRGRPAVGLVVETEAWHYLSLRISRGEIFLALRDLSSKLVVEESQELALKDDLPLLDRIISHIDQFFIRHQKKLERLTSIAITLPGIIDTENGIVHRMPFYEDVKEMPLGEALEQHTGVPVYIQHDISAWTMAEALFGASRGARDVIQVVIDHNVGAGVITDGHLLHAGSSSLVEIGHTQVDPYGKRCYCGNHGCLETIASVDSILELAQLRLNQSMSSMLHGQPLTVDSLCQAALRGDLLAKDIITGVGAHVGRILAIMVNLFNPQKILIGSPLSKAADILFPVISDSIRQQALPAYSQHISVESTQFSNQGTMAGAALVKDAMYNGSLLIRLLQG 423608797FC980CB 423608797FC980CB ptgcb_ecoli PTS system glucose-specific EIICB component ptsG glcA umg b1101 EIICB-Glc JW1087 protein protein ecoli Escherichia coli (strain K12) MFKNAFANLQKVGKSLMLPVSVLPIAGILLGVGSANFSWLPAVVSHVMAEAGGSVFANMPLIFAIGVALGFTNNDGVSALAAVVAYGIMVKTMAVVAPLVLHLPAEEIASKHLADTGVLGGIISGAIAAYMFNRFYRIKLPEYLGFFAGKRFVPIISGLAAIFTGVVLSFIWPPIGSAIQTFSQWAAYQNPVVAFGIYGFIERCLVPFGLHHIWNVPFQMQIGEYTNAAGQVFHGDIPRYMAGDPTAGKLSGGFLFKMYGLPAAAIAIWHSAKPENRAKVGGIMISAALTSFLTGITEPIEFSFMFVAPILYIIHAILAGLAFPICILLGMRDGTSFSHGLIDFIVLSGNSSKLWLFPIVGIGYAIVYYTIFRVLIKALDLKTPGREDATEDAKATGTSEMAPALVAAFGGKENITNLDACITRLRVSVADVSKVDQAGLKKLGAAGVVVAGSGVQAIFGTKSDNLKTEMDEYIRNH D97A80FD64B74F73 D97A80FD64B74F73 grx2eiib Grx2-EIIB protein protein ecolx Escherichia coli MKLYIYDHCPYCLKARMIFGLKNIPVELHVLLNDDAETPTRMVGQKQVPILQKDDSRYMPESMDIVHYVDKLDGKPLLTGKRSPAIEEWLRKVNGYANKLLLPRFAKSAFDEFSTPAARKYFVDKKEASAGNFADLLAHSDGLIKNISDDLRALDKLIVKPNAVNGELSEDDIQLFPLLRNLTLVAGINWPSRVADYRDNMAKQTQINLLSSMAIMFKNAFANLQKVGKSLMLPVSVLPIAGILLGVGSANFSWLPAVVSHVMAEAGGSVFANMPLIFAIGVALGFTNNDGVSALAAVVAYGIMVKTMAVVAPLVLHLPAEEIASKHLADTGVLGGIISGAIAAYMFNRFYRIKLPEYLGFFAGKRFVPIISGLAAIFTGVVLSFIWPPIGSAIQTFSQWAAYQNPVVAFGIYGFIERCLVPFGLHHIWNVPFQMQIGEYTNAAGQVFHGDIPRYMAGDPTAGKLSGGFLFKMYGLPAAAIAIWHSAKPENRAKVGGIMISAALTSFLTGITEPIEFSFMFVAPILYIIHAILAGLAFPICILLGMRDGTSFSHGLIDFIVLSGNSSKLWLFPIVGIGYAIVYYTIFRVLIKALDLKTPGREDATEDAKATGTSEMAPALVAAFGGKENITNLDACITRLRVSVADVSKVDQAGLKKLGAAGVVVAGSGVQAIFGTKSDNLKTEMDEYIRNH mlc-1 2 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction grx2eiib-mlc-1 4 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association eiib-mlc-1 1 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction eiib-mlc-2 3 6 unspecified role unspecified role bait bait P69786:p.Val449Gln V449Q mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V Q This feature has been corrected as a result of our quality control procedures. The original label was 'V449Q'. Wed May 02 17:17:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val449gln' Tue Jun 30 18:55:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val449Gln' P69786:p.Gln456Ala Q456A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Q A This feature has been corrected as a result of our quality control procedures. The original label was 'Q456A'. Wed May 02 15:40:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln456ala' Tue Jun 30 17:02:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln456Ala' P69786:p.Ala451Phe A451F mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain A F This feature has been corrected as a result of our quality control procedures. The original label was 'A451F'. Wed May 02 16:14:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala451phe' Tue Jun 30 16:27:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala451Phe' ecolx Escherichia coli 5 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction