DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu In vitro self-assembly of tailorable nanotubes from a simple protein building block. In vitro self-assembly of tailorable nanotubes from a simple protein building block. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Ballister ER., Lai AH., Zuckermann RN., Cheng Y., Mougous JD. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Ballister ER., Lai AH., Zuckermann RN., Cheng Y., Mougous JD. DIP original experiment: DIP-68499X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx In vitro self-assembly of tailorable nanotubes from a simple protein building block. In vitro self-assembly of tailorable nanotubes from a simple protein building block. In vitro self-assembly of tailorable nanotubes from a simple protein building block. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Ballister ER., Lai AH., Zuckermann RN., Cheng Y., Mougous JD. Only protein-protein interactions ecolx Escherichia coli tem transmission electron microscopy tem predetermined predetermined participant predetermined Ballister ER., Lai AH., Zuckermann RN., Cheng Y., Mougous JD. DIP original experiment: DIP-68500X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx In vitro self-assembly of tailorable nanotubes from a simple protein building block. In vitro self-assembly of tailorable nanotubes from a simple protein building block. In vitro self-assembly of tailorable nanotubes from a simple protein building block. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Ballister ER., Lai AH., Zuckermann RN., Cheng Y., Mougous JD. Only protein-protein interactions ecolx Escherichia coli comigration in sds comigration in sds page comigration in sds predetermined predetermined participant predetermined Ballister ER., Lai AH., Zuckermann RN., Cheng Y., Mougous JD. DIP original experiment: DIP-68501X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx In vitro self-assembly of tailorable nanotubes from a simple protein building block. hcp1_pseae Protein hcp1 hcp1 PA0085 protein protein pseae Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) MAVDMFIKIGDVKGESKDKTHAEEIDVLAWSWGMSQSGSMHMGGGGGAGKVNVQDLSFTKYIDKSTPNLMMACSSGKHYPQAKLTIRKAGGENQVEYLIITLKEVLVSSVSTGGSGGEDRLTENVTLNFAQVQVDYQPQKADGAKDGGPVKYGWNIRQNVQA BFC45EC5C8107BF5 hcp1-1 1 4 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction hcp1-2 2 4 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction hcp1-3 3 4 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction