DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Caldendrin-Jacob: a protein liaison that couples NMDA receptor signalling to the nucleus. Caldendrin-Jacob: a protein liaison that couples NMDA receptor signalling to the nucleus. PLoS biology 2008 imex curation Dieterich DC., Karpova A., Mikhaylova M., Zdobnova I., König I., Landwehr M., Kreutz M., Smalla KH., Richter K., Landgraf P., Reissner C., Boeckers TM., Zuschratter W., Spilker C., Seidenbecher CI., Garner CC., Gundelfinger ED., Kreutz MR. Only protein-protein interactions rat Rattus norvegicus (Rat) Rat anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Dieterich DC., Karpova A., Mikhaylova M., Zdobnova I., König I., Landwehr M., Kreutz M., Smalla KH., Richter K., Landgraf P., Reissner C., Boeckers TM., Zuschratter W., Spilker C., Seidenbecher CI., Garner CC., Gundelfinger ED., Kreutz MR. DIP original experiment: DIP-110880X PLoS biology 2008 IMEx Caldendrin-Jacob: a protein liaison that couples NMDA receptor signalling to the nucleus. Caldendrin-Jacob: a protein liaison that couples NMDA receptor signalling to the nucleus. Caldendrin-Jacob: a protein liaison that couples NMDA receptor signalling to the nucleus. PLoS biology 2008 imex curation Dieterich DC., Karpova A., Mikhaylova M., Zdobnova I., König I., Landwehr M., Kreutz M., Smalla KH., Richter K., Landgraf P., Reissner C., Boeckers TM., Zuschratter W., Spilker C., Seidenbecher CI., Garner CC., Gundelfinger ED., Kreutz MR. Only protein-protein interactions rat Rattus norvegicus (Rat) Rat anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Dieterich DC., Karpova A., Mikhaylova M., Zdobnova I., König I., Landwehr M., Kreutz M., Smalla KH., Richter K., Landgraf P., Reissner C., Boeckers TM., Zuschratter W., Spilker C., Seidenbecher CI., Garner CC., Gundelfinger ED., Kreutz MR. DIP original experiment: DIP-110881X PLoS biology 2008 IMEx Caldendrin-Jacob: a protein liaison that couples NMDA receptor signalling to the nucleus. Caldendrin-Jacob: a protein liaison that couples NMDA receptor signalling to the nucleus. Caldendrin-Jacob: a protein liaison that couples NMDA receptor signalling to the nucleus. PLoS biology 2008 imex curation Dieterich DC., Karpova A., Mikhaylova M., Zdobnova I., König I., Landwehr M., Kreutz M., Smalla KH., Richter K., Landgraf P., Reissner C., Boeckers TM., Zuschratter W., Spilker C., Seidenbecher CI., Garner CC., Gundelfinger ED., Kreutz MR. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Dieterich DC., Karpova A., Mikhaylova M., Zdobnova I., König I., Landwehr M., Kreutz M., Smalla KH., Richter K., Landgraf P., Reissner C., Boeckers TM., Zuschratter W., Spilker C., Seidenbecher CI., Garner CC., Gundelfinger ED., Kreutz MR. DIP original experiment: DIP-110877X PLoS biology 2008 IMEx Caldendrin-Jacob: a protein liaison that couples NMDA receptor signalling to the nucleus. Caldendrin-Jacob: a protein liaison that couples NMDA receptor signalling to the nucleus. Caldendrin-Jacob: a protein liaison that couples NMDA receptor signalling to the nucleus. PLoS biology 2008 imex curation Dieterich DC., Karpova A., Mikhaylova M., Zdobnova I., König I., Landwehr M., Kreutz M., Smalla KH., Richter K., Landgraf P., Reissner C., Boeckers TM., Zuschratter W., Spilker C., Seidenbecher CI., Garner CC., Gundelfinger ED., Kreutz MR. Only protein-protein interactions rat Rattus norvegicus (Rat) Rat anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Dieterich DC., Karpova A., Mikhaylova M., Zdobnova I., König I., Landwehr M., Kreutz M., Smalla KH., Richter K., Landgraf P., Reissner C., Boeckers TM., Zuschratter W., Spilker C., Seidenbecher CI., Garner CC., Gundelfinger ED., Kreutz MR. DIP original experiment: DIP-110882X PLoS biology 2008 IMEx Caldendrin-Jacob: a protein liaison that couples NMDA receptor signalling to the nucleus. Caldendrin-Jacob: a protein liaison that couples NMDA receptor signalling to the nucleus. Caldendrin-Jacob: a protein liaison that couples NMDA receptor signalling to the nucleus. PLoS biology 2008 imex curation Dieterich DC., Karpova A., Mikhaylova M., Zdobnova I., König I., Landwehr M., Kreutz M., Smalla KH., Richter K., Landgraf P., Reissner C., Boeckers TM., Zuschratter W., Spilker C., Seidenbecher CI., Garner CC., Gundelfinger ED., Kreutz MR. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Dieterich DC., Karpova A., Mikhaylova M., Zdobnova I., König I., Landwehr M., Kreutz M., Smalla KH., Richter K., Landgraf P., Reissner C., Boeckers TM., Zuschratter W., Spilker C., Seidenbecher CI., Garner CC., Gundelfinger ED., Kreutz MR. DIP original experiment: DIP-110879X PLoS biology 2008 IMEx Caldendrin-Jacob: a protein liaison that couples NMDA receptor signalling to the nucleus. Caldendrin-Jacob: a protein liaison that couples NMDA receptor signalling to the nucleus. Caldendrin-Jacob: a protein liaison that couples NMDA receptor signalling to the nucleus. PLoS biology 2008 imex curation Dieterich DC., Karpova A., Mikhaylova M., Zdobnova I., König I., Landwehr M., Kreutz M., Smalla KH., Richter K., Landgraf P., Reissner C., Boeckers TM., Zuschratter W., Spilker C., Seidenbecher CI., Garner CC., Gundelfinger ED., Kreutz MR. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Dieterich DC., Karpova A., Mikhaylova M., Zdobnova I., König I., Landwehr M., Kreutz M., Smalla KH., Richter K., Landgraf P., Reissner C., Boeckers TM., Zuschratter W., Spilker C., Seidenbecher CI., Garner CC., Gundelfinger ED., Kreutz MR. DIP original experiment: DIP-110883X PLoS biology 2008 IMEx Caldendrin-Jacob: a protein liaison that couples NMDA receptor signalling to the nucleus. Caldendrin-Jacob: a protein liaison that couples NMDA receptor signalling to the nucleus. Caldendrin-Jacob: a protein liaison that couples NMDA receptor signalling to the nucleus. PLoS biology 2008 imex curation Dieterich DC., Karpova A., Mikhaylova M., Zdobnova I., König I., Landwehr M., Kreutz M., Smalla KH., Richter K., Landgraf P., Reissner C., Boeckers TM., Zuschratter W., Spilker C., Seidenbecher CI., Garner CC., Gundelfinger ED., Kreutz MR. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Dieterich DC., Karpova A., Mikhaylova M., Zdobnova I., König I., Landwehr M., Kreutz M., Smalla KH., Richter K., Landgraf P., Reissner C., Boeckers TM., Zuschratter W., Spilker C., Seidenbecher CI., Garner CC., Gundelfinger ED., Kreutz MR. DIP original experiment: DIP-110876X PLoS biology 2008 IMEx Caldendrin-Jacob: a protein liaison that couples NMDA receptor signalling to the nucleus. Caldendrin-Jacob: a protein liaison that couples NMDA receptor signalling to the nucleus. Caldendrin-Jacob: a protein liaison that couples NMDA receptor signalling to the nucleus. PLoS biology 2008 imex curation Dieterich DC., Karpova A., Mikhaylova M., Zdobnova I., König I., Landwehr M., Kreutz M., Smalla KH., Richter K., Landgraf P., Reissner C., Boeckers TM., Zuschratter W., Spilker C., Seidenbecher CI., Garner CC., Gundelfinger ED., Kreutz MR. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Dieterich DC., Karpova A., Mikhaylova M., Zdobnova I., König I., Landwehr M., Kreutz M., Smalla KH., Richter K., Landgraf P., Reissner C., Boeckers TM., Zuschratter W., Spilker C., Seidenbecher CI., Garner CC., Gundelfinger ED., Kreutz MR. DIP original experiment: DIP-110878X PLoS biology 2008 IMEx Caldendrin-Jacob: a protein liaison that couples NMDA receptor signalling to the nucleus. q9epi6-1 NMDA receptor synaptonuclear signaling and neuronal migration factor Nsmf Jac Nelf Juxtasynaptic attractor of caldendrin on dendritic boutons protein Nasal embryonic luteinizing hormone-releasing hormone factor protein protein rat Rattus norvegicus (Rat) Rat MGAAASRRRALRSEAMSSVAAKVRAARAFGEYLSQSHPENRNGADHLLADAYSGHEGSPEMQPAPHNKRRLSLVSNGRYEGSISDEAVSGKTATEGPQPRVYTISREPALLPGSEAEAIELAVVKGRRQRERHPHHHSQPLRASPGSSREDISRPCQSWAGSRQGSKECPGCAKLVPGPSPRAFGLEQPPLPEASGRHKKLERMYSVDGVSDDVPIRTWFPKENPFSFQTATTTMQAISVFRGYAERKRRKRENDSASVIQRNFRKHLRMVGSRRVKAQTFAERRERSFSRSWSDPTPMKADTSHDSRDSSDLQSSHCTLDEACEDLDWDTEKGLEATACDTEGFLPPKVMLISSKVPKAEYIPTIIRRDDPSIIPILYDHEHATFEDILEEIEKKLNIYHKGAKIWKMLIFCQGGPGHLYLLKNKVATFAKVEKEEDMIHFWKRLSRLMSKVNPEPNVIHIMGCYILGNPNGEKLFQNLRTLMTPYKVTFESPLELSAQGKQMIETYFDFRLYRLWKSRQHSKLLDFDDVL DIP protein Q9EPI6-1 original sequence version: 32 q99nf2-1 NMDA receptor synaptonuclear signaling and neuronal migration factor Nsmf Jac Nelf Juxtasynaptic attractor of caldendrin on dendritic boutons protein Nasal embryonic luteinizing hormone-releasing hormone factor protein protein mouse Mus musculus Mouse MGAAASRRRALRSEAMSSVAAKVRAARAFGEYLSQSHPENRNGADHLLADAYSGHDGSPEMQPAPQNKRRLSLVSNGRYEGSISDEAVSGKPAIEGPQPHVYTISREPALLPGSEAEAIELAVVKGRRQRERHPHHHSQPLRASPGSSREDISRPCQSWAGSRQGSKECPGCAQLVPGPSSRAFGLEQPPLPEAPGRHKKLERMYSVDGVSDDVPIRTWFPKENLFSFQTATTTMQAISVFRGYAERKRRKRENDSASVIQRNFRKHLRMVGSRRVKAQTFAERRERSFSRSWSDPTPMKADTSHDSRDSSDLQSSHCTLDEACEDLDWDTEKGLEAMACNTEGFLPPKVMLISSKVPKAEYIPTIIRRDDPSIIPILYDHEHATFEDILEEIEKKLNIYHKGAKIWKMLIFCQGGPGHLYLLKNKVATFAKVEKEEDMIHFWKRLSRLMSKVNPEPNVIHIMGCYILGNPNGEKLFQNLRTLMTPYKVTFESPLELSAQGKQMIETYFDFRLYRLWKSRQHSKLLDFDDVL DIP protein Q99NF2-1 original sequence version: 42 ima5_rat Importin subunit alpha-5 Kpna1 Importin alpha-5 Karyopherin subunit alpha-1 protein protein rat Rattus norvegicus (Rat) Rat MSTPGKENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEETEEEVMSDGGFHEAQINNMEMAPGGVITSDMTEMIFSNSPEQQLSATQKFRKLLSKEPNPPIDEVINTPGVVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMTRNAVWALSNLCRGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACWTISNITAGNRAQIQTVIDANMFPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVELGCIKPLCDLLTVMDAKIVQVALNGLENILRLGEQEAKRNGSGINPYCALIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYFGTEDEDSSIAPQVDLSQQQYIFQQCEAPMEGSQL DIP protein P83953 original sequence version: 39 DIP protein P83953 original sequence version: 83 B5B66B860D96EC5B o88751-1 Calcium-binding protein 1 Cabp1 Caldendrin protein protein rat Rattus norvegicus (Rat) Rat MSSHIAKSESKTSLLKAAAASGGSRAPRHSSARDPGLRGRRLPGPCPDSPATCGDPSSRRPLCRPVPRDEGARGSRRGLPQAHCRPRETLPPARGRDGEERGLAPALSLRGSLRSRGRGDPAPAGTPEADPFLHQLRPMLSSAFGQDRSLRPEEIEELREAFREFDKDKDGYINCRDLGNCMRTMGYMPTEMELIELSQQINMNLGGHVDFDDFVELMGPKLLAETADMIGVKELRDAFREFDTNGDGEISTSELREAMRKLLGHQVGHRDIEEIIRDVDLNGDGRVDFEEFVRMMSR DIP protein O88751-1 original sequence version: 59 Major isoform expressed in the brain. kpna1-nsmf-1 6 10 unspecified role unspecified role prey prey Region 247-252 Region 247-252 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human 11 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction cabp1-nsmf-1 8 9 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat 12 unspecified role unspecified role bait bait Region 137-298 Region 137-298 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli physical association physical association cabp1-nsmf-2 7 12 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 9 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction cabp1-nsmf-3 1 9 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat 12 unspecified role unspecified role bait bait rat Rattus norvegicus (Rat) Rat physical association physical association nsmf-cabp1-1 2 9 unspecified role unspecified role bait bait rat Rattus norvegicus (Rat) Rat 12 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat physical association physical association cabp1-nsmf-4 3 10 unspecified role unspecified role prey prey Region 1-249 Region 1-249 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Q99NF2-1:p.Phe241Glu F241E mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F E This feature has been corrected as a result of our quality control procedures. The original label was 'F241E'. Wed May 02 15:50:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe241glu' Tue Jun 30 16:42:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe241Glu' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 12 unspecified role unspecified role bait bait Region 65-229 Region 65-229 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction cabp1-nsmf-5 5 10 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey 12 unspecified role unspecified role bait bait Region 137-298 Region 137-298 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli direct interaction direct interaction nsmf-kpna1-1 4 11 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat 9 unspecified role unspecified role bait bait rat Rattus norvegicus (Rat) Rat physical association physical association