DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Hax1-mediated processing of HtrA2 by Parl allows survival of lymphocytes and neurons. Hax1-mediated processing of HtrA2 by Parl allows survival of lymphocytes and neurons. Nature 2008 imex curation Chao JR., Parganas E., Boyd K., Hong CY., Opferman JT., Ihle JN. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Chao JR., Parganas E., Boyd K., Hong CY., Opferman JT., Ihle JN. DIP original experiment: DIP-250272X Nature 2008 IMEx Hax1-mediated processing of HtrA2 by Parl allows survival of lymphocytes and neurons. Hax1-mediated processing of HtrA2 by Parl allows survival of lymphocytes and neurons. Hax1-mediated processing of HtrA2 by Parl allows survival of lymphocytes and neurons. Nature 2008 imex curation Chao JR., Parganas E., Boyd K., Hong CY., Opferman JT., Ihle JN. Only protein-protein interactions chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Chao JR., Parganas E., Boyd K., Hong CY., Opferman JT., Ihle JN. DIP original experiment: DIP-250275X Nature 2008 IMEx Hax1-mediated processing of HtrA2 by Parl allows survival of lymphocytes and neurons. Hax1-mediated processing of HtrA2 by Parl allows survival of lymphocytes and neurons. Hax1-mediated processing of HtrA2 by Parl allows survival of lymphocytes and neurons. Nature 2008 imex curation Chao JR., Parganas E., Boyd K., Hong CY., Opferman JT., Ihle JN. Only protein-protein interactions chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chao JR., Parganas E., Boyd K., Hong CY., Opferman JT., Ihle JN. DIP original experiment: DIP-250274X Nature 2008 IMEx Hax1-mediated processing of HtrA2 by Parl allows survival of lymphocytes and neurons. Hax1-mediated processing of HtrA2 by Parl allows survival of lymphocytes and neurons. Hax1-mediated processing of HtrA2 by Parl allows survival of lymphocytes and neurons. Nature 2008 imex curation Chao JR., Parganas E., Boyd K., Hong CY., Opferman JT., Ihle JN. Only protein-protein interactions chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Chao JR., Parganas E., Boyd K., Hong CY., Opferman JT., Ihle JN. DIP original experiment: DIP-250276X Nature 2008 IMEx Hax1-mediated processing of HtrA2 by Parl allows survival of lymphocytes and neurons. Hax1-mediated processing of HtrA2 by Parl allows survival of lymphocytes and neurons. Hax1-mediated processing of HtrA2 by Parl allows survival of lymphocytes and neurons. Nature 2008 imex curation Chao JR., Parganas E., Boyd K., Hong CY., Opferman JT., Ihle JN. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Chao JR., Parganas E., Boyd K., Hong CY., Opferman JT., Ihle JN. DIP original experiment: DIP-250273X Nature 2008 IMEx Hax1-mediated processing of HtrA2 by Parl allows survival of lymphocytes and neurons. hax1_mouse HCLS1-associated protein X-1 HS1-associating protein X-1 HS1-binding protein 1 Hax1 Hs1bp1 protein protein mouse Mus musculus Mouse MSVFDLFRGFFGFPGPRSHRDPFFGGMTRDDDDDDDDDDEAEEDRGAWGRESYAFDGSQPPEEFGFSFSPRGGMRFHGNFGFDDLVRDFNSIFSEMGAWTLPSHSPELPGPESETPGERLREGQTLRDSMLKYPDSHQPRIFEGVLESHAKPESPKPAPDWGSQGPFHRLDDTWPVSPHSRAKEDKDLDSQVSQEGLGPLLQPQPKSYFKSISVTKITKPDGTVEERRTVVDSEGRRETTVTHQEAHDSSRSDPDSQRSSALDDPFSILDLLLGRWFRSR DIP protein O35387 original sequence version: 97 3123979BA10B45D1 parl_mouse Presenilins-associated rhomboid-like protein, mitochondrial Parl Psarl Mitochondrial intramembrane-cleaving protease PARL protein protein mouse Mus musculus Mouse MALQGWVQRGWRCGPAWAPPLGGGYRELSATQAPRLLGRRFNLFVQQKCGFRKAPRKVEPRRSDTGSSGEAYKRSALIPPLEETVFYPSPYPIRTLVKPFFFTIGFTGCAFGSAAIWQYESLKSRVQSYFDGIKADWLDSIRPQKEGNLRKEINKWWNSLSDGQRTVTGIIAANALVFCLWRVPSLQRTMIRYFTSNPASKVLCSPMLLSTFSHFSLFHMAANMYVLWSFSSSIVNILGQEQFVAVYLSAGVISNFVSYVCKVATGRYGPSLGASGAIMTVLAAVCTKIPEGRLAIIFLPVFTFTAGNALKAIIAMDTAGMILGWKFFDHAAHLGGALFGIWYITYGHELIWKNREPLVKIWHEIRTNGPKKGGGSK DIP protein Q5XJY4 original sequence version: 82 41C81310031A2EC4 htra2_mouse Serine protease HTRA2, mitochondrial Htra2 Omi Prss25 High temperature requirement protein A2 Omi stress-regulated endoprotease Serine proteinase OMI Serine protease 25 protein protein mouse Mus musculus Mouse MAALKAGRGANWSLRAWRALGGIFWRKPPLLAPDLRALLTSGTPDSQIWMTYGTPSLPAQVPEGFLASRADLTSRTPDLWARLNVGTSGSSDQEARRSPGSRRREWLAVAVGAGGAVVLLLWGWGRGLSTVLAAVPAPPPTSPRSQYNFIADVVEKTAPAVVYIEILDRHPFSGREVPISNGSGFVVASDGLIVTNAHVVADRRRVRVRLPSGDTYEAMVTAVDPVADIATLRIQTKEPLPTLPLGRSADVRQGEFVVAMGSPFALQNTITSGIVSSAQRPARDLGLPQNNVEYIQTDAAIDFGNSGGPLVNLDGEVIGVNTMKVTAGISFAIPSDRLREFLHRGEKKNSWFGTSGSQRRYIGVMMLTLTPSILIELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEKLAQNAEDVYEAVRTQSQLAVRIRRGSETLTLYVTPEVTE DIP protein Q9JIY5 original sequence version: 116 DIP protein Q9JIY5 original sequence version: 79 C1E77346FB8D75BD parl-hax1-1 1 7 unspecified role unspecified role bait bait mouse Mus musculus Mouse 6 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association parl-hax1-2 4 7 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey 6 unspecified role unspecified role prey prey Binding region 201-228 Binding region 201-228 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Binding region 73-100 Binding region 73-100 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey physical association physical association htra2-hax1-1 2 8 unspecified role unspecified role bait bait Binding region 134-349 Binding region 134-349 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey 6 unspecified role unspecified role prey prey Binding region 183-235 Binding region 183-235 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey physical association physical association htra2-hax1-2 5 8 unspecified role unspecified role bait bait mouse Mus musculus Mouse 6 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association hax1-htra2-1 3 8 unspecified role unspecified role prey prey Binding region 134-349 Binding region 134-349 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey 6 unspecified role unspecified role bait bait Binding region 183-235 Binding region 183-235 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey physical association physical association