DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes. Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes. Nature structural & molecular biology 2008 imex curation Yashiroda H., Mizushima T., Okamoto K., Kameyama T., Hayashi H., Kishimoto T., Niwa S., Kasahara M., Kurimoto E., Sakata E., Takagi K., Suzuki A., Hirano Y., Murata S., Kato K., Yamane T., Tanaka K. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Yashiroda H., Mizushima T., Okamoto K., Kameyama T., Hayashi H., Kishimoto T., Niwa S., Kasahara M., Kurimoto E., Sakata E., Takagi K., Suzuki A., Hirano Y., Murata S., Kato K., Yamane T., Tanaka K. DIP original experiment: DIP-132537X Nature structural & molecular biology 2008 IMEx Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes. Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes. Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes. Nature structural & molecular biology 2008 imex curation Yashiroda H., Mizushima T., Okamoto K., Kameyama T., Hayashi H., Kishimoto T., Niwa S., Kasahara M., Kurimoto E., Sakata E., Takagi K., Suzuki A., Hirano Y., Murata S., Kato K., Yamane T., Tanaka K. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Yashiroda H., Mizushima T., Okamoto K., Kameyama T., Hayashi H., Kishimoto T., Niwa S., Kasahara M., Kurimoto E., Sakata E., Takagi K., Suzuki A., Hirano Y., Murata S., Kato K., Yamane T., Tanaka K. DIP original experiment: DIP-132532X Nature structural & molecular biology 2008 IMEx Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes. Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes. Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes. Nature structural & molecular biology 2008 imex curation Yashiroda H., Mizushima T., Okamoto K., Kameyama T., Hayashi H., Kishimoto T., Niwa S., Kasahara M., Kurimoto E., Sakata E., Takagi K., Suzuki A., Hirano Y., Murata S., Kato K., Yamane T., Tanaka K. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Yashiroda H., Mizushima T., Okamoto K., Kameyama T., Hayashi H., Kishimoto T., Niwa S., Kasahara M., Kurimoto E., Sakata E., Takagi K., Suzuki A., Hirano Y., Murata S., Kato K., Yamane T., Tanaka K. DIP original experiment: DIP-132531X Nature structural & molecular biology 2008 IMEx Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes. Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes. Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes. Nature structural & molecular biology 2008 imex curation Yashiroda H., Mizushima T., Okamoto K., Kameyama T., Hayashi H., Kishimoto T., Niwa S., Kasahara M., Kurimoto E., Sakata E., Takagi K., Suzuki A., Hirano Y., Murata S., Kato K., Yamane T., Tanaka K. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Yashiroda H., Mizushima T., Okamoto K., Kameyama T., Hayashi H., Kishimoto T., Niwa S., Kasahara M., Kurimoto E., Sakata E., Takagi K., Suzuki A., Hirano Y., Murata S., Kato K., Yamane T., Tanaka K. DIP original experiment: DIP-132524X Nature structural & molecular biology 2008 IMEx Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes. Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes. Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes. Nature structural & molecular biology 2008 imex curation Yashiroda H., Mizushima T., Okamoto K., Kameyama T., Hayashi H., Kishimoto T., Niwa S., Kasahara M., Kurimoto E., Sakata E., Takagi K., Suzuki A., Hirano Y., Murata S., Kato K., Yamane T., Tanaka K. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Yashiroda H., Mizushima T., Okamoto K., Kameyama T., Hayashi H., Kishimoto T., Niwa S., Kasahara M., Kurimoto E., Sakata E., Takagi K., Suzuki A., Hirano Y., Murata S., Kato K., Yamane T., Tanaka K. DIP original experiment: DIP-132534X Nature structural & molecular biology 2008 IMEx Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes. Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes. Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes. Nature structural & molecular biology 2008 imex curation Yashiroda H., Mizushima T., Okamoto K., Kameyama T., Hayashi H., Kishimoto T., Niwa S., Kasahara M., Kurimoto E., Sakata E., Takagi K., Suzuki A., Hirano Y., Murata S., Kato K., Yamane T., Tanaka K. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast density sedimentation cosedimentation through density gradient density sedimentation anti tag western anti tag western blot anti tag western Yashiroda H., Mizushima T., Okamoto K., Kameyama T., Hayashi H., Kishimoto T., Niwa S., Kasahara M., Kurimoto E., Sakata E., Takagi K., Suzuki A., Hirano Y., Murata S., Kato K., Yamane T., Tanaka K. DIP original experiment: DIP-132525X Nature structural & molecular biology 2008 IMEx Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes. Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes. Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes. Nature structural & molecular biology 2008 imex curation Yashiroda H., Mizushima T., Okamoto K., Kameyama T., Hayashi H., Kishimoto T., Niwa S., Kasahara M., Kurimoto E., Sakata E., Takagi K., Suzuki A., Hirano Y., Murata S., Kato K., Yamane T., Tanaka K. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Yashiroda H., Mizushima T., Okamoto K., Kameyama T., Hayashi H., Kishimoto T., Niwa S., Kasahara M., Kurimoto E., Sakata E., Takagi K., Suzuki A., Hirano Y., Murata S., Kato K., Yamane T., Tanaka K. DIP original experiment: DIP-132535X Nature structural & molecular biology 2008 IMEx Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes. Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes. Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes. Nature structural & molecular biology 2008 imex curation Yashiroda H., Mizushima T., Okamoto K., Kameyama T., Hayashi H., Kishimoto T., Niwa S., Kasahara M., Kurimoto E., Sakata E., Takagi K., Suzuki A., Hirano Y., Murata S., Kato K., Yamane T., Tanaka K. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Yashiroda H., Mizushima T., Okamoto K., Kameyama T., Hayashi H., Kishimoto T., Niwa S., Kasahara M., Kurimoto E., Sakata E., Takagi K., Suzuki A., Hirano Y., Murata S., Kato K., Yamane T., Tanaka K. DIP original experiment: DIP-132538X Nature structural & molecular biology 2008 IMEx Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes. Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes. Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes. Nature structural & molecular biology 2008 imex curation Yashiroda H., Mizushima T., Okamoto K., Kameyama T., Hayashi H., Kishimoto T., Niwa S., Kasahara M., Kurimoto E., Sakata E., Takagi K., Suzuki A., Hirano Y., Murata S., Kato K., Yamane T., Tanaka K. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Yashiroda H., Mizushima T., Okamoto K., Kameyama T., Hayashi H., Kishimoto T., Niwa S., Kasahara M., Kurimoto E., Sakata E., Takagi K., Suzuki A., Hirano Y., Murata S., Kato K., Yamane T., Tanaka K. DIP original experiment: DIP-132536X Nature structural & molecular biology 2008 IMEx Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes. Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes. Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes. Nature structural & molecular biology 2008 imex curation Yashiroda H., Mizushima T., Okamoto K., Kameyama T., Hayashi H., Kishimoto T., Niwa S., Kasahara M., Kurimoto E., Sakata E., Takagi K., Suzuki A., Hirano Y., Murata S., Kato K., Yamane T., Tanaka K. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Yashiroda H., Mizushima T., Okamoto K., Kameyama T., Hayashi H., Kishimoto T., Niwa S., Kasahara M., Kurimoto E., Sakata E., Takagi K., Suzuki A., Hirano Y., Murata S., Kato K., Yamane T., Tanaka K. DIP original experiment: DIP-132533X Nature structural & molecular biology 2008 IMEx Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes. Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes. Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes. Nature structural & molecular biology 2008 imex curation Yashiroda H., Mizushima T., Okamoto K., Kameyama T., Hayashi H., Kishimoto T., Niwa S., Kasahara M., Kurimoto E., Sakata E., Takagi K., Suzuki A., Hirano Y., Murata S., Kato K., Yamane T., Tanaka K. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Yashiroda H., Mizushima T., Okamoto K., Kameyama T., Hayashi H., Kishimoto T., Niwa S., Kasahara M., Kurimoto E., Sakata E., Takagi K., Suzuki A., Hirano Y., Murata S., Kato K., Yamane T., Tanaka K. DIP original experiment: DIP-132527X Nature structural & molecular biology 2008 IMEx Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes. Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes. Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes. Nature structural & molecular biology 2008 imex curation Yashiroda H., Mizushima T., Okamoto K., Kameyama T., Hayashi H., Kishimoto T., Niwa S., Kasahara M., Kurimoto E., Sakata E., Takagi K., Suzuki A., Hirano Y., Murata S., Kato K., Yamane T., Tanaka K. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Yashiroda H., Mizushima T., Okamoto K., Kameyama T., Hayashi H., Kishimoto T., Niwa S., Kasahara M., Kurimoto E., Sakata E., Takagi K., Suzuki A., Hirano Y., Murata S., Kato K., Yamane T., Tanaka K. DIP original experiment: DIP-132523X Nature structural & molecular biology 2008 IMEx Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes. Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes. Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes. Nature structural & molecular biology 2008 imex curation Yashiroda H., Mizushima T., Okamoto K., Kameyama T., Hayashi H., Kishimoto T., Niwa S., Kasahara M., Kurimoto E., Sakata E., Takagi K., Suzuki A., Hirano Y., Murata S., Kato K., Yamane T., Tanaka K. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Yashiroda H., Mizushima T., Okamoto K., Kameyama T., Hayashi H., Kishimoto T., Niwa S., Kasahara M., Kurimoto E., Sakata E., Takagi K., Suzuki A., Hirano Y., Murata S., Kato K., Yamane T., Tanaka K. DIP original experiment: DIP-132528X Nature structural & molecular biology 2008 IMEx Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes. Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes. Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes. Nature structural & molecular biology 2008 imex curation Yashiroda H., Mizushima T., Okamoto K., Kameyama T., Hayashi H., Kishimoto T., Niwa S., Kasahara M., Kurimoto E., Sakata E., Takagi K., Suzuki A., Hirano Y., Murata S., Kato K., Yamane T., Tanaka K. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Yashiroda H., Mizushima T., Okamoto K., Kameyama T., Hayashi H., Kishimoto T., Niwa S., Kasahara M., Kurimoto E., Sakata E., Takagi K., Suzuki A., Hirano Y., Murata S., Kato K., Yamane T., Tanaka K. DIP original experiment: DIP-132529X Nature structural & molecular biology 2008 IMEx Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes. Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes. Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes. Nature structural & molecular biology 2008 imex curation Yashiroda H., Mizushima T., Okamoto K., Kameyama T., Hayashi H., Kishimoto T., Niwa S., Kasahara M., Kurimoto E., Sakata E., Takagi K., Suzuki A., Hirano Y., Murata S., Kato K., Yamane T., Tanaka K. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip ms participant Identification by mass spectrometry ms participant Yashiroda H., Mizushima T., Okamoto K., Kameyama T., Hayashi H., Kishimoto T., Niwa S., Kasahara M., Kurimoto E., Sakata E., Takagi K., Suzuki A., Hirano Y., Murata S., Kato K., Yamane T., Tanaka K. DIP original experiment: DIP-132522X Nature structural & molecular biology 2008 IMEx Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes. Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes. Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes. Nature structural & molecular biology 2008 imex curation Yashiroda H., Mizushima T., Okamoto K., Kameyama T., Hayashi H., Kishimoto T., Niwa S., Kasahara M., Kurimoto E., Sakata E., Takagi K., Suzuki A., Hirano Y., Murata S., Kato K., Yamane T., Tanaka K. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Yashiroda H., Mizushima T., Okamoto K., Kameyama T., Hayashi H., Kishimoto T., Niwa S., Kasahara M., Kurimoto E., Sakata E., Takagi K., Suzuki A., Hirano Y., Murata S., Kato K., Yamane T., Tanaka K. DIP original experiment: DIP-132530X Nature structural & molecular biology 2008 IMEx Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes. Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes. Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes. Nature structural & molecular biology 2008 imex curation Yashiroda H., Mizushima T., Okamoto K., Kameyama T., Hayashi H., Kishimoto T., Niwa S., Kasahara M., Kurimoto E., Sakata E., Takagi K., Suzuki A., Hirano Y., Murata S., Kato K., Yamane T., Tanaka K. Only protein-protein interactions ecolx Escherichia coli pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Yashiroda H., Mizushima T., Okamoto K., Kameyama T., Hayashi H., Kishimoto T., Niwa S., Kasahara M., Kurimoto E., Sakata E., Takagi K., Suzuki A., Hirano Y., Murata S., Kato K., Yamane T., Tanaka K. DIP original experiment: DIP-132526X Nature structural & molecular biology 2008 IMEx Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes. psa7_yeast Probable proteasome subunit alpha type-7 PRE10 PRC1 PRS1 O6650 YOR362C Proteasome component C1 Macropain subunit C1 Proteinase YSCE subunit 1 Multicatalytic endopeptidase complex subunit C1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MTSIGTGYDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCNDGVVFAVEKLITSKLLVPQKNVKIQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKLYKTPIPIPAFADRLGQYVQAHTLYNSVRPFGVSTIFGGVDKNGAHLYMLEPSGSYWGYKGAATGKGRQSAKAELEKLVDHHPEGLSAREAVKQAAKIIYLAHEDNKEKDFELEISWCSLSETNGLHKFVKGDLLQEAIDFAQKEINGDDDEDEDDSDNVMSSDDENAPVATNANATTDQEGDIHLE 1E51D904CF336747 1E51D904CF336747 psa2_yeast Proteasome subunit alpha type-2 PRE8 PRS4 YML092C Proteasome component Y7 Macropain subunit Y7 Proteinase YSCE subunit 7 Multicatalytic endopeptidase complex subunit Y7 protein protein yeast Saccharomyces cerevisiae Baker's yeast MTDRYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLAMSETLSKVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTSYKRIYGEYPPTKLLVSEVAKIMQEATQSGGVRPFGVSLLIAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDELELEDAIHIALLTLKESVEGEFNGDTIELAIIGDENPDLLGYTGIPTDKGPRFRKLTSQEINDRLEAL 12D7DFB1AA10E9FE 12D7DFB1AA10E9FE poc4_yeast Proteasome chaperone 4 POC4 YPL144W DMP1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MLVKTISRTIESESGFLQPTLDVIATLPADDRSKKIPISLVVGFKQEASLNSSSSLSCYYYAIPLMRDRHINLKSGGSNVVGIPLLDTKDDRIRDMARHMATIISERFNRPCYVTWSSLPSEDPSMLVANHLYILKKCLDLLKTELGE 1CC7C6074CF4AC08 1CC7C6074CF4AC08 poc3_yeast Proteasome chaperone 3 POC3 Increased recombination centers protein 25 IRC25 DMP2 YLR021W protein protein yeast Saccharomyces cerevisiae Baker's yeast MISYEFQTHLPKGKDSSLNASSENKELYVQATHFNNTILLQIRLNGEMDSTYEVSSKGLNPILDINVPLAGNLGNTGGDYDDEEEEFVRDHLSDYQVVTKLGDSADPKVPVVCVQIAELYRRVILPEVSGTMAQDNMQFSLLISMSSKIWRATKEQSADDNDFGKLVFVLKCIKDMYAK 6CA25E8ED0491EE2 6CA25E8ED0491EE2 psa5_yeast Proteasome subunit alpha type-5 PUP2 DOA5 YGR253C G9155 Proteasome component PUP2 Macropain subunit PUP2 Proteinase YSCE subunit PUP2 Multicatalytic endopeptidase complex subunit PUP2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MFLTRSEYDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLESDSIEKIVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEGASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLNEWHSSLTLKEAELLVLKILKQVMEEKLDENNAQLSCITKQDGFKIYDNEKTAELIKELKEKEAAESPEEADVEMS E8EDEB212BF4EC6E E8EDEB212BF4EC6E psa6_yeast Proteasome subunit alpha type-6 PRE5 YMR314W YM9924.06 Proteasome component PRE5 Macropain subunit PRE5 Proteinase YSCE subunit PRE5 Multicatalytic endopeptidase complex subunit PRE5 protein protein yeast Saccharomyces cerevisiae Baker's yeast MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADELSSYQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAVERAGHLLCDKAQKNTQSYGGRPYGVGLLIIGYDKSGAHLLEFQPSGNVTELYGTAIGARSQGAKTYLERTLDTFIKIDGNPDELIKAGVEAISQSLRDESLTVDNLSIAIVGKDTPFTIYDGEAVAKYI C43CBCC1C6B9E39E C43CBCC1C6B9E39E psb2_yeast Proteasome subunit beta type-2 PUP1 YOR157C Macropain subunit PUP1 Proteinase YSCE subunit PUP1 Multicatalytic endopeptidase complex subunit PUP1 Proteasome component PUP1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MAGLSFDNYQRNNFLAENSHTQPKATSTGTTIVGVKFNNGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAVTQLIGSNIELHSLYTSREPRVVSALQMLKQHLFKYQGHIGAYLIVAGVDPTGSHLFSIHAHGSTDVGYYLSLGSGSLAAMAVLESHWKQDLTKEEAIKLASDAIQAGIWNDLGSGSNVDVCVMEIGKDAEYLRNYLTPNVREEKQKSYKFPRGTTAVLKESIVNICDIQEEQVDITA 13A8F2B75584539A 13A8F2B75584539A psa4_yeast Proteasome subunit alpha type-4 PRE6 YOL038W Proteasome component PRE6 Macropain subunit PRE6 Proteinase YSCE subunit PRE6 Multicatalytic endopeptidase complex subunit PRE6 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSGYDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSKVSKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQSGGVRPFGVSTLIAGFDPRDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNYDRKEPPATVEECVKLTVRSLLEVVQTGAKNIEITVVKPDSDIVALSSEEINQYVTQIEQEKQEQQEQDKKKKSNH 73AEE63B836E618A 73AEE63B836E618A psa3_yeast Proteasome subunit alpha type-3 PRE9 YGR135W PRS5 Proteasome component Y13 Macropain subunit Y13 Proteinase YSCE subunit 13 Multicatalytic endopeptidase complex subunit Y13 protein protein yeast Saccharomyces cerevisiae Baker's yeast MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKIAVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIELALKTLSKTTDSSALTYDRLEFATIRKGANDGEVYQKIFKPQEIKDILVKTGITKKDEDEEADEDMK B43BB05233A01A9E B43BB05233A01A9E psa1_yeast Proteasome subunit alpha type-1 SCL1 PRC2 PRS2 YGL011C Proteasome component C7-alpha Macropain subunit C7-alpha Proteinase YSCE subunit 7 Multicatalytic endopeptidase complex C7 Proteasome component Y8 SCL1 suppressor protein protein protein yeast Saccharomyces cerevisiae Baker's yeast MSGAAAASAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSLAVRGKDCTVVISQKKVPDKLLDPTTVSYIFCISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQRAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENHFKKSKIDHINEESWEKVVEFAITHMIDALGTEFSKNDLEVGVATKDKFFTLSAENIEERLVAIAEQD 5B938C862BC8D7EB 5B938C862BC8D7EB dmp1-alpha_6-1 7 23 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 20 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association dmp1-alpha_5-1 15 23 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 22 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 21 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 20 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association dmp1-alpha_2-1 3 19 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 20 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association dmp1-dmp2-1 17 21 unspecified role unspecified role prey prey ecolx Escherichia coli 20 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association dmp1-alpha_7-1 9 18 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 20 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association dmp1-dmp2-2 11 21 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 20 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction dmp1-alpha_3-1 2 26 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 20 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association dmp1-dmp2-3 12 21 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 20 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association dmp1-beta_2-1 1 24 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 20 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association dmp1-alpha_4-1 10 25 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 20 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association dmp1-dmp2-4 13 21 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 20 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction alpha_5-dmp1-1 14 22 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 21 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 20 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction dmp2-dmp1-1 4 21 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 20 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association alpha_5-dmp1-2 8 22 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 21 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 20 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association dmp1-alpha_5-2 5 22 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 20 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association dmp1-alpha_1-1 16 27 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 20 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association dmp1-dmp2-5 6 21 unspecified role unspecified role unspecified role unspecified role HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 20 unspecified role unspecified role unspecified role unspecified role Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association