DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The ankyrin repeats of G9a and GLP histone methyltransferases are mono- and dimethyllysine binding modules. The ankyrin repeats of G9a and GLP histone methyltransferases are mono- and dimethyllysine binding modules. Nature structural & molecular biology 2008 imex curation Collins RE., Northrop JP., Horton JR., Lee DY., Zhang X., Stallcup MR., Cheng X. Only protein-protein interactions chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Collins RE., Northrop JP., Horton JR., Lee DY., Zhang X., Stallcup MR., Cheng X. DIP original experiment: DIP-132512X Nature structural & molecular biology 2008 IMEx The ankyrin repeats of G9a and GLP histone methyltransferases are mono- and dimethyllysine binding modules. The ankyrin repeats of G9a and GLP histone methyltransferases are mono- and dimethyllysine binding modules. The ankyrin repeats of G9a and GLP histone methyltransferases are mono- and dimethyllysine binding modules. Nature structural & molecular biology 2008 imex curation Collins RE., Northrop JP., Horton JR., Lee DY., Zhang X., Stallcup MR., Cheng X. Only protein-protein interactions in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Collins RE., Northrop JP., Horton JR., Lee DY., Zhang X., Stallcup MR., Cheng X. DIP original experiment: DIP-132516X Nature structural & molecular biology 2008 IMEx The ankyrin repeats of G9a and GLP histone methyltransferases are mono- and dimethyllysine binding modules. The ankyrin repeats of G9a and GLP histone methyltransferases are mono- and dimethyllysine binding modules. The ankyrin repeats of G9a and GLP histone methyltransferases are mono- and dimethyllysine binding modules. Nature structural & molecular biology 2008 imex curation Collins RE., Northrop JP., Horton JR., Lee DY., Zhang X., Stallcup MR., Cheng X. Only protein-protein interactions in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Collins RE., Northrop JP., Horton JR., Lee DY., Zhang X., Stallcup MR., Cheng X. DIP original experiment: DIP-132511X Nature structural & molecular biology 2008 IMEx The ankyrin repeats of G9a and GLP histone methyltransferases are mono- and dimethyllysine binding modules. The ankyrin repeats of G9a and GLP histone methyltransferases are mono- and dimethyllysine binding modules. The ankyrin repeats of G9a and GLP histone methyltransferases are mono- and dimethyllysine binding modules. Nature structural & molecular biology 2008 imex curation Collins RE., Northrop JP., Horton JR., Lee DY., Zhang X., Stallcup MR., Cheng X. Only protein-protein interactions in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Collins RE., Northrop JP., Horton JR., Lee DY., Zhang X., Stallcup MR., Cheng X. DIP original experiment: DIP-132517X Nature structural & molecular biology 2008 IMEx The ankyrin repeats of G9a and GLP histone methyltransferases are mono- and dimethyllysine binding modules. The ankyrin repeats of G9a and GLP histone methyltransferases are mono- and dimethyllysine binding modules. The ankyrin repeats of G9a and GLP histone methyltransferases are mono- and dimethyllysine binding modules. Nature structural & molecular biology 2008 imex curation Collins RE., Northrop JP., Horton JR., Lee DY., Zhang X., Stallcup MR., Cheng X. Only protein-protein interactions in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Collins RE., Northrop JP., Horton JR., Lee DY., Zhang X., Stallcup MR., Cheng X. DIP original experiment: DIP-132515X Nature structural & molecular biology 2008 IMEx The ankyrin repeats of G9a and GLP histone methyltransferases are mono- and dimethyllysine binding modules. The ankyrin repeats of G9a and GLP histone methyltransferases are mono- and dimethyllysine binding modules. The ankyrin repeats of G9a and GLP histone methyltransferases are mono- and dimethyllysine binding modules. Nature structural & molecular biology 2008 imex curation Collins RE., Northrop JP., Horton JR., Lee DY., Zhang X., Stallcup MR., Cheng X. Only protein-protein interactions in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Collins RE., Northrop JP., Horton JR., Lee DY., Zhang X., Stallcup MR., Cheng X. DIP original experiment: DIP-132510X Nature structural & molecular biology 2008 IMEx The ankyrin repeats of G9a and GLP histone methyltransferases are mono- and dimethyllysine binding modules. The ankyrin repeats of G9a and GLP histone methyltransferases are mono- and dimethyllysine binding modules. The ankyrin repeats of G9a and GLP histone methyltransferases are mono- and dimethyllysine binding modules. Nature structural & molecular biology 2008 imex curation Collins RE., Northrop JP., Horton JR., Lee DY., Zhang X., Stallcup MR., Cheng X. Only protein-protein interactions in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps predetermined predetermined participant predetermined Collins RE., Northrop JP., Horton JR., Lee DY., Zhang X., Stallcup MR., Cheng X. DIP original experiment: DIP-132508X Nature structural & molecular biology 2008 IMEx The ankyrin repeats of G9a and GLP histone methyltransferases are mono- and dimethyllysine binding modules. The ankyrin repeats of G9a and GLP histone methyltransferases are mono- and dimethyllysine binding modules. The ankyrin repeats of G9a and GLP histone methyltransferases are mono- and dimethyllysine binding modules. Nature structural & molecular biology 2008 imex curation Collins RE., Northrop JP., Horton JR., Lee DY., Zhang X., Stallcup MR., Cheng X. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Collins RE., Northrop JP., Horton JR., Lee DY., Zhang X., Stallcup MR., Cheng X. DIP original experiment: DIP-132507X Nature structural & molecular biology 2008 IMEx The ankyrin repeats of G9a and GLP histone methyltransferases are mono- and dimethyllysine binding modules. The ankyrin repeats of G9a and GLP histone methyltransferases are mono- and dimethyllysine binding modules. The ankyrin repeats of G9a and GLP histone methyltransferases are mono- and dimethyllysine binding modules. Nature structural & molecular biology 2008 imex curation Collins RE., Northrop JP., Horton JR., Lee DY., Zhang X., Stallcup MR., Cheng X. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Collins RE., Northrop JP., Horton JR., Lee DY., Zhang X., Stallcup MR., Cheng X. DIP original experiment: DIP-132514X Nature structural & molecular biology 2008 IMEx The ankyrin repeats of G9a and GLP histone methyltransferases are mono- and dimethyllysine binding modules. The ankyrin repeats of G9a and GLP histone methyltransferases are mono- and dimethyllysine binding modules. The ankyrin repeats of G9a and GLP histone methyltransferases are mono- and dimethyllysine binding modules. Nature structural & molecular biology 2008 imex curation Collins RE., Northrop JP., Horton JR., Lee DY., Zhang X., Stallcup MR., Cheng X. Only protein-protein interactions chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Collins RE., Northrop JP., Horton JR., Lee DY., Zhang X., Stallcup MR., Cheng X. DIP original experiment: DIP-132513X Nature structural & molecular biology 2008 IMEx The ankyrin repeats of G9a and GLP histone methyltransferases are mono- and dimethyllysine binding modules. The ankyrin repeats of G9a and GLP histone methyltransferases are mono- and dimethyllysine binding modules. The ankyrin repeats of G9a and GLP histone methyltransferases are mono- and dimethyllysine binding modules. Nature structural & molecular biology 2008 imex curation Collins RE., Northrop JP., Horton JR., Lee DY., Zhang X., Stallcup MR., Cheng X. Only protein-protein interactions in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps predetermined predetermined participant predetermined Collins RE., Northrop JP., Horton JR., Lee DY., Zhang X., Stallcup MR., Cheng X. DIP original experiment: DIP-132509X Nature structural & molecular biology 2008 IMEx The ankyrin repeats of G9a and GLP histone methyltransferases are mono- and dimethyllysine binding modules. ncoa2_mouse Nuclear receptor coactivator 2 Transcriptional intermediary factor 2 Glucocorticoid receptor-interacting protein 1 Ncoa2 Grip1 Tif2 Src2 Steroid receptor coactivator 2 protein protein mouse Mus musculus Mouse MSGMGENTSDPSRAETRKRKECPDQLGPSPKRSTEKRNREQENKYIEELAELIFANFNDIDNFNFKPDKCAILKETVKQIRQIKEQEKAAAANIDEVQKSDVSSTGQGVIDKDALGPMMLEALDGFFFVVNLEGSVVFVSENVTQYLRYNQEELMNKSVYSILHVGDHTEFVKNLLPKSMVNGGSWSGEPPRRSSHTFNCRMLVKPLPDSEEEGHDSQEAHQKYEAMQCFAVSQPKSIKEEGEDLQSCLICVARRVPMKERPTLPSSESFTTRQDLQGKITSLDTSTMRAAMKPGWEDLVRRCIQKFHTQHEGESLSYAKRHHHEVLRQGLAFSQIYRFSLSDGTLVAAQTKSKLIRSQTTNEPQLVISLHMLHREQNVCVMNPDLTGQAMGKPLNPISSSSPAHQALCSGNPGQDMTLGSNINFPMNGPKEQMGMPMGRFGGSGGMNHVSGMQATTPQGSNYALKMNSPSQSSPGMNPGQASSVLSPRQRMSPGVAGSPRIPPSQFSPAGSLHSPVGVCSSTGNSHSYTNSSLNALQALSEGHGVSLGSSLASPDLKMGNLQNSPVNMNPPPLSKMGSLDSKDCFGLYGEPSEGTTGQAEASCHPEEQKGPNDSSMPQAASGDRAEGHSRLHDSKGQTKLLQLLTTKSDQMEPSPLPSSLSDTNKDSTGSLPGPGSTHGTSLKEKHKILHRLLQDSSSPVDLAKLTAEATGKELSQESSSTAPGSEVTVKQEPASPKKKENALLRYLLDKDDTKDIGLPEITPKLERLDSKTDPASNTKLIAMKTVKEEVSFEPSDQPGSELDNLEEILDDLQNSQLPQLFPDTRPGAPTGSVDKQAIINDLMQLTADSSPVPPAGAQKAALRMSQSTFNNPRPGQLGRLLPNQNLPLDITLQSPTGAGPFPPIRNSSPYSVIPQPGMMGNQGMLGSQGNLGNNSTGMIGSSTSRPSMPSGEWAPQSPAVRVTCAATTGAMNRPVQGGMIRNPTASIPMRANSQPGQRQMLQSQVMNIGPSELEMNMGGPQYNQQQAPPNQTAPWPESILPIDQASFASQNRQPFGSSPDDLLCPHPAAESPSDEGALLDQLYLALRNFDGLEEIDRALGIPELVSQSQAVDAEQFSSQESSIMLEQKPPVFPQQYASQAQMAQGGYNPMQDPNFHTMGQRPNYTTLRMQPRPGLRPTGIVQNQPNQLRLQLQHRLQAQQNRQPLMNQISSVSNVNLTLRPGVPTQAPINAQMLAQRQREILNQHLRQRQMQQQVQQRTLMMRGQGLNVTPSMVAPAGLPAAMSNPRIPQANAQQFPFPPNYGISQQPDPGFTGATTPQSPLMSPRMAHTQSPMMQQSQANPAYQPTSDMNGWAQGSMGGNSMFSQQSPPHFGQQANTSMYSNNMNISVSMATNTGGLSSMNQMTGQMSMTSVTSVPTSGLPSMGPEQVNDPALRGGNLFPNQLPGMDMIKQEGDASRKYC DIP protein Q61026 original sequence version: 150 DIP protein Q61026 original sequence version: 105 DIP protein Q61026 original sequence version: 107 619462FF1ACC6067 q9h9b1-1 Histone-lysine N-methyltransferase EHMT1 EHMT1 EUHMTASE1 GLP KIAA1876 KMT1D Euchromatic histone-lysine N-methyltransferase 1 G9a-like protein 1 Histone H3-K9 methyltransferase 5 Lysine N-methyltransferase 1D protein protein human Homo sapiens Human MAAADAEAVPARGEPQQDCCVKTELLGEETPMAADEGSAEKQAGEAHMAADGETNGSCENSDASSHANAAKHTQDSARVNPQDGTNTLTRIAENGVSERDSEAAKQNHVTADDFVQTSVIGSNGYILNKPALQAQPLRTTSTLASSLPGHAAKTLPGGAGKGRTPSAFPQTPAAPPATLGEGSADTEDRKLPAPGADVKVHRARKTMPKSVVGLHAASKDPREVREARDHKEPKEEINKNISDFGRQQLLPPFPSLHQSLPQNQCYMATTKSQTACLPFVLAAAVSRKKKRRMGTYSLVPKKKTKVLKQRTVIEMFKSITHSTVGSKGEKDLGASSLHVNGESLEMDSDEDDSEELEEDDGHGAEQAAAFPTEDSRTSKESMSEADRAQKMDGESEEEQESVDTGEEEEGGDESDLSSESSIKKKFLKRKGKTDSPWIKPARKRRRRSRKKPSGALGSESYKSSAGSAEQTAPGDSTGYMEVSLDSLDLRVKGILSSQAEGLANGPDVLETDGLQEVPLCSCRMETPKSREITTLANNQCMATESVDHELGRCTNSVVKYELMRPSNKAPLLVLCEDHRGRMVKHQCCPGCGYFCTAGNFMECQPESSISHRFHKDCASRVNNASYCPHCGEESSKAKEVTIAKADTTSTVTPVPGQEKGSALEGRADTTTGSAAGPPLSEDDKLQGAASHVPEGFDPTGPAGLGRPTPGLSQGPGKETLESALIALDSEKPKKLRFHPKQLYFSARQGELQKVLLMLVDGIDPNFKMEHQNKRSPLHAAAEAGHVDICHMLVQAGANIDTCSEDQRTPLMEAAENNHLEAVKYLIKAGALVDPKDAEGSTCLHLAAKKGHYEVVQYLLSNGQMDVNCQDDGGWTPMIWATEYKHVDLVKLLLSKGSDINIRDNEENICLHWAAFSGCVDIAEILLAAKCDLHAVNIHGDSPLHIAARENRYDCVVLFLSRDSDVTLKNKEGETPLQCASLNSQVWSALQMSKALQDSAPDRPSPVERIVSRDIARGYERIPIPCVNAVDSEPCPSNYKYVSQNCVTSPMNIDRNITHLQYCVCIDDCSSSNCMCGQLSMRCWYDKDGRLLPEFNMAEPPLIFECNHACSCWRNCRNRVVQNGLRARLQLYRTRDMGWGVRSLQDIPPGTFVCEYVGELISDSEADVREEDSYLFDLDNKDGEVYCIDARFYGNVSRFINHHCEPNLVPVRVFMAHQDLRFPRIAFFSTRLIEAGEQLGFDYGERFWDIKGKLFSCRCGSPKCRHSSAALAQRQASAAQEAQEDGLPDTSSAAAADPL DIP protein Q9H9B1-1 original sequence version: 104 DIP protein Q9H9B1 original sequence version: 169 DIP protein Q9H9B1 original sequence version: 112 q9z148-1 Histone-lysine N-methyltransferase EHMT2 G9a-L Ehmt2 Bat8 G9a Ng36 Euchromatic histone-lysine N-methyltransferase 2 HLA-B-associated transcript 8 Histone H3-K9 methyltransferase 3 Protein G9a protein protein mouse Mus musculus Mouse MRGLPRGRGLMRARGRGRAAPTGGRGRGRGGAHRGRGRPRSLLSLPRAQASWAPQLPAGLTGPPVPCLPSQGEAPAEMGALLLEKEPRGAAERVHSSLGDTPQSEETLPKANPDSLEPAGPSSPASVTVTVGDEGADTPVGAASLIGDEPESLEGDGGRIVLGHATKSFPSSPSKGGACPSRAKMSMTGAGKSPPSVQSLAMRLLSMPGAQGAATAGPEPSPATTAAQEGQPKVHRARKTMSKPSNGQPPIPEKRPPEVQHFRMSDDMHLGKVTSDVAKRRKLNSGSLSEDLGSAGGSGDIILEKGEPRPLEEWETVVGDDFSLYYDAYSVDERVDSDSKSEVEALAEQLSEEEEEEEEEEEEEEEEEEEEEEEEEDEESGNQSDRSGSSGRRKAKKKWRKDSPWVKPSRKRRKREPPRAKEPRGVNGVGSSGPSEYMEVPLGSLELPSEGTLSPNHAGVSNDTSSLETERGFEELPLCSCRMEAPKIDRISERAGHKCMATESVDGELLGCNAAILKRETMRPSSRVALMVLCEAHRARMVKHHCCPGCGYFCTAGTFLECHPDFRVAHRFHKACVSQLNGMVFCPHCGEDASEAQEVTIPRGDGGTPPIGTAAPALPPLAHDAPGRADTSQPSARMRGHGEPRRPPCDPLADTIDSSGPSLTLPNGGCLSAVGLPPGPGREALEKALVIQESERRKKLRFHPRQLYLSVKQGELQKVILMLLDNLDPNFQSDQQSKRTPLHAAAQKGSVEICHVLLQAGANINAVDKQQRTPLMEAVVNNHLEVARYMVQLGGCVYSKEEDGSTCLHHAAKIGNLEMVSLLLSTGQVDVNAQDSGGWTPIIWAAEHKHIDVIRMLLTRGADVTLTDNEENICLHWASFTGSAAIAEVLLNAQCDLHAVNYHGDTPLHIAARESYHDCVLLFLSRGANPELRNKEGDTAWDLTPERSDVWFALQLNRKLRLGVGNRAVRTEKIICRDVARGYENVPIPCVNGVDGEPCPEDYKYISENCETSTMNIDRNITHLQHCTCVDDCSSSNCLCGQLSIRCWYDKDGRLLQEFNKIEPPLIFECNQACSCWRSCKNRVVQSGIKVRLQLYRTAKMGWGVRALQTIPQGTFICEYVGELISDAEADVREDDSYLFDLDNKDGEVYCIDARYYGNISRFINHLCDPNIIPVRVFMLHQDLRFPRIAFFSSRDIRTGEELGFDYGDRFWDIKSKYFTCQCGSEKCKHSAEAIALEQSRLARLDPHPELLPDLSSLPPINT DIP protein Q9Z148-1 original sequence version: 97 DIP protein Q9Z148-1 original sequence version: 81 DIP protein Q9Z148 original sequence version: 131 DIP protein Q9Z148 original sequence version: 97 DIP protein Q9Z148 original sequence version: 104 74DBFF9A36769589 h3k9-2 Histone H3 N-terminal Peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) ARTKQTARKSTGGKAPRKQLA gfi1_human Zinc finger protein Gfi-1 Growth factor independent protein 1 Zinc finger protein 163 GFI1 ZNF163 protein protein human Homo sapiens Human MPRSFLVKSKKAHSYHQPRSPGPDYSLRLENVPAPSRADSTSNAGGAKAEPRDRLSPESQLTEAPDRASASPDSCEGSVCERSSEFEDFWRPPSPSASPASEKSMCPSLDEAQPFPLPFKPYSWSGLAGSDLRHLVQSYRPCGALERGAGLGLFCEPAPEPGHPAALYGPKRAAGGAGAGAPGSCSAGAGATAGPGLGLYGDFGSAAAGLYERPTAAAGLLYPERGHGLHADKGAGVKVESELLCTRLLLGGGSYKCIKCSKVFSTPHGLEVHVRRSHSGTRPFACEMCGKTFGHAVSLEQHKAVHSQERSFDCKICGKSFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKKHTFIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFGCDLCGKGFQRKVDLRRHRETQHGLK DIP protein Q99684 original sequence version: 93 DIP protein Q99684 original sequence version: 94 740A466F72C5FC72 ehmt1-h3k9-1 8 15 unspecified role unspecified role unspecified role unspecified role Region 1-15 Region 1-15 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain in vitro In vitro 13 unspecified role unspecified role unspecified role unspecified role Region 734-968 Region 734-968 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction h3k9-ehmt1-1 3 13 unspecified role unspecified role prey prey Region 734-968 Region 734-968 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain in vitro In vitro 15 unspecified role unspecified role bait bait Biotin-tag Biotin-tag biotin tag biotin tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal K9me1 K9me1 n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys certain certain sequence position certain certain certain sequence position certain K9me2 K9me2 n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain in vitro In vitro direct interaction direct interaction ehmt2-gfi1-1 10 16 unspecified role unspecified role prey prey Region 1-271 Region 1-271 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey 14 unspecified role unspecified role bait bait Q9Z148-1:p.Glu847Ala E847A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E A This feature has been corrected as a result of our quality control procedures. The original label was 'E847A'. Wed May 02 14:39:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu847ala' Tue Jun 30 18:47:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu847Ala' Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q9Z148-1:p.Trp839Ala W839A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain W A This feature has been corrected as a result of our quality control procedures. The original label was 'W839A'. Wed May 02 19:49:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp839ala' Tue Jun 30 15:57:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp839Ala' chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey physical association physical association h3k9-ehmt2-1 2 14 unspecified role unspecified role prey prey Region 936-1263 Region 936-1263 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 15 unspecified role unspecified role bait bait Biotin-tag Biotin-tag biotin tag biotin tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal in vitro In vitro direct interaction direct interaction ehmt1-h3k9-2 9 15 unspecified role unspecified role unspecified role unspecified role Region 1-15 Region 1-15 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain K9me2 K9me2 n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain in vitro In vitro 13 unspecified role unspecified role unspecified role unspecified role Region 734-968 Region 734-968 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction ehmt2-h3k9-1 11 14 unspecified role unspecified role unspecified role unspecified role Region 730-965 Region 730-965 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 15 unspecified role unspecified role unspecified role unspecified role Region 1-15 Region 1-15 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Fluorescein-label Fluorescein-label fluorescent dye fluorescent dye label fluorescent dye n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal K9me1 K9me1 n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys certain certain sequence position certain certain certain sequence position certain K9me2 K9me2 n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain in vitro In vitro direct interaction direct interaction ehmt2-ncoa2-1 1 12 unspecified role unspecified role prey prey Region 5-479 Region 5-479 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey 14 unspecified role unspecified role bait bait Region 730-965 Region 730-965 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Q9Z148-1:p.Glu847Ala E847A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E A This feature has been corrected as a result of our quality control procedures. The original label was 'E847A'. Wed May 02 15:36:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu847ala' Tue Jun 30 18:13:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu847Ala' Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey physical association physical association ehmt1-h3k9-3 7 15 unspecified role unspecified role unspecified role unspecified role Region 1-15 Region 1-15 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Fluorescein-label Fluorescein-label fluorescent dye fluorescent dye label fluorescent dye n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal K9me1 K9me1 n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys certain certain sequence position certain certain certain sequence position certain K9me2 K9me2 n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain in vitro In vitro 13 unspecified role unspecified role unspecified role unspecified role Region 734-968 Region 734-968 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction h3k9-ehmt1-2 4 13 unspecified role unspecified role prey prey in vitro In vitro 15 unspecified role unspecified role bait bait Biotin-tag Biotin-tag biotin tag biotin tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal K9me1 K9me1 n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys certain certain sequence position certain certain certain sequence position certain K9me2 K9me2 n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain K4me1 K4me1 n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys certain certain sequence position certain certain certain sequence position certain K4me2 K4me2 n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain in vitro In vitro direct interaction direct interaction h3k9-ehmt2-2 6 14 unspecified role unspecified role prey prey Q9Z148-1:p.Glu847Ala E847A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E A This feature has been corrected as a result of our quality control procedures. The original label was 'E847A'. Wed May 02 15:09:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu847ala' Tue Jun 30 17:47:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu847Ala' Q9Z148-1:p.Trp839Ala W839A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain W A This feature has been corrected as a result of our quality control procedures. The original label was 'W839A'. Wed May 02 17:47:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp839ala' Tue Jun 30 17:55:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp839Ala' Q9Z148-1:p.Glu870Arg E870R mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E R This feature has been corrected as a result of our quality control procedures. The original label was 'E870R'. Wed May 02 18:04:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu870arg' Tue Jun 30 16:35:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu870Arg' Q9Z148-1:p.Asp905Arg D905R mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D R This feature has been corrected as a result of our quality control procedures. The original label was 'D905R'. Wed May 02 16:25:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp905arg' Tue Jun 30 19:35:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp905Arg' Q9Z148-1:p.Trp844Ala W844A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain W A This feature has been corrected as a result of our quality control procedures. The original label was 'W844A'. Wed May 02 18:40:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp844ala' Tue Jun 30 17:30:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp844Ala' Q9Z148-1:p.Trp877Ala W877A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain W A This feature has been corrected as a result of our quality control procedures. The original label was 'W877A'. Wed May 02 19:03:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp877ala' Tue Jun 30 19:12:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp877Ala' in vitro In vitro 15 unspecified role unspecified role bait bait Biotin-tag Biotin-tag biotin tag biotin tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal K9me1 K9me1 n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys certain certain sequence position certain certain certain sequence position certain K9me2 K9me2 n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain K9me3 K9me3 n6me3+lys N6,N6,N6-trimethyl-L-lysine (5S)-5-amino-5-carboxy-N,N,N-trimethylpentan-1-aminium 2-amino-6-(trimethylammonio)hexanoic acid 5-azanyl-5-carboxy-N,N,N-trimethylpentanazanium MOD_RES N6,N6,N6-trimethyllysine N(zeta)-trimethyllysine N6,N6,N6-trimethyl-L-lysine N6,N6,N6-trimethylated L-lysine N6,N6,N6-trimethyllysin-N6-ium N6,N6,N6-trimethyllysine cation epsilon-trimethyllysine N-trimethylation (of lysine) N6Me3+Lys Trimethyl tri-Methylation certain certain sequence position certain certain certain sequence position certain K4me1 K4me1 n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys certain certain sequence position certain certain certain sequence position certain K4me2 K4me2 n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain in vitro In vitro direct interaction direct interaction h3k9-ehmt2-3 5 14 unspecified role unspecified role prey prey Region 730-965 Region 730-965 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain in vitro In vitro 15 unspecified role unspecified role bait bait Biotin-tag Biotin-tag biotin tag biotin tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal K9me1 K9me1 n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys certain certain sequence position certain certain certain sequence position certain K9me2 K9me2 n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain in vitro In vitro direct interaction direct interaction