DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Extended polypeptide linkers establish the spatial architecture of a pyruvate dehydrogenase multienzyme complex. Extended polypeptide linkers establish the spatial architecture of a pyruvate dehydrogenase multienzyme complex. Structure (London, England : 1993) 2008 imex curation Lengyel JS., Stott KM., Wu X., Brooks BR., Balbo A., Schuck P., Perham RN., Subramaniam S., Milne JL. Only protein-protein interactions ecolx Escherichia coli 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Lengyel JS., Stott KM., Wu X., Brooks BR., Balbo A., Schuck P., Perham RN., Subramaniam S., Milne JL. DIP original experiment: DIP-68053X Structure (London, England : 1993) 2008 IMEx Extended polypeptide linkers establish the spatial architecture of a pyruvate dehydrogenase multienzyme complex. Extended polypeptide linkers establish the spatial architecture of a pyruvate dehydrogenase multienzyme complex. Extended polypeptide linkers establish the spatial architecture of a pyruvate dehydrogenase multienzyme complex. Structure (London, England : 1993) 2008 imex curation Lengyel JS., Stott KM., Wu X., Brooks BR., Balbo A., Schuck P., Perham RN., Subramaniam S., Milne JL. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Lengyel JS., Stott KM., Wu X., Brooks BR., Balbo A., Schuck P., Perham RN., Subramaniam S., Milne JL. DIP original experiment: DIP-68049X Structure (London, England : 1993) 2008 IMEx Extended polypeptide linkers establish the spatial architecture of a pyruvate dehydrogenase multienzyme complex. Extended polypeptide linkers establish the spatial architecture of a pyruvate dehydrogenase multienzyme complex. Extended polypeptide linkers establish the spatial architecture of a pyruvate dehydrogenase multienzyme complex. Structure (London, England : 1993) 2008 imex curation Lengyel JS., Stott KM., Wu X., Brooks BR., Balbo A., Schuck P., Perham RN., Subramaniam S., Milne JL. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Lengyel JS., Stott KM., Wu X., Brooks BR., Balbo A., Schuck P., Perham RN., Subramaniam S., Milne JL. DIP original experiment: DIP-68050X Structure (London, England : 1993) 2008 IMEx Extended polypeptide linkers establish the spatial architecture of a pyruvate dehydrogenase multienzyme complex. Extended polypeptide linkers establish the spatial architecture of a pyruvate dehydrogenase multienzyme complex. Extended polypeptide linkers establish the spatial architecture of a pyruvate dehydrogenase multienzyme complex. Structure (London, England : 1993) 2008 imex curation Lengyel JS., Stott KM., Wu X., Brooks BR., Balbo A., Schuck P., Perham RN., Subramaniam S., Milne JL. Only protein-protein interactions in vitro In vitro 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Lengyel JS., Stott KM., Wu X., Brooks BR., Balbo A., Schuck P., Perham RN., Subramaniam S., Milne JL. DIP original experiment: DIP-68051X Structure (London, England : 1993) 2008 IMEx Extended polypeptide linkers establish the spatial architecture of a pyruvate dehydrogenase multienzyme complex. Extended polypeptide linkers establish the spatial architecture of a pyruvate dehydrogenase multienzyme complex. Extended polypeptide linkers establish the spatial architecture of a pyruvate dehydrogenase multienzyme complex. Structure (London, England : 1993) 2008 imex curation Lengyel JS., Stott KM., Wu X., Brooks BR., Balbo A., Schuck P., Perham RN., Subramaniam S., Milne JL. Only protein-protein interactions in vitro In vitro 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Lengyel JS., Stott KM., Wu X., Brooks BR., Balbo A., Schuck P., Perham RN., Subramaniam S., Milne JL. DIP original experiment: DIP-68052X Structure (London, England : 1993) 2008 IMEx Extended polypeptide linkers establish the spatial architecture of a pyruvate dehydrogenase multienzyme complex. odp2_human Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial DLAT DLTA 70 kDa mitochondrial autoantigen of primary biliary cirrhosis Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex M2 antigen complex 70 kDa subunit Pyruvate dehydrogenase complex component E2 protein protein human Homo sapiens Human MWRVCARRAQNVAPWAGLEARWTALQEVPGTPRVTSRSGPAPARRNSVTTGYGGVRALCGWTPSSGATPRNRLLLQLLGSPGRRYYSLPPHQKVPLPSLSPTMQAGTIARWEKKEGDKINEGDLIAEVETDKATVGFESLEECYMAKILVAEGTRDVPIGAIICITVGKPEDIEAFKNYTLDSSAAPTPQAAPAPTPAATASPPTPSAQAPGSSYPPHMQVLLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEGTRDVPLGTPLCIIVEKEADISAFADYRPTEVTDLKPQVPPPTPPPVAAVPPTPQPLAPTPSAPCPATPAGPKGRVFVSPLAKKLAVEKGIDLTQVKGTGPDGRITKKDIDSFVPSKVAPAPAAVVPPTGPGMAPVPTGVFTDIPISNIRRVIAQRLMQSKQTIPHYYLSIDVNMGEVLLVRKELNKILEGRSKISVNDFIIKASALACLKVPEANSSWMDTVIRQNHVVDVSVAVSTPAGLITPIVFNAHIKGVETIANDVVSLATKAREGKLQPHEFQGGTFTISNLGMFGIKNFSAIINPPQACILAIGASEDKLVPADNEKGFDVASMMSVTLSCDHRVVDGAVGAQWLAEFRKYLEKPITMLL DIP protein P10515 original sequence version: 103 DIP protein P10515 original sequence version: 108 DIP protein P10515 original sequence version: 115 DD93A8E666E377C2 odpa_geose Pyruvate dehydrogenase E1 component subunit alpha pdhA protein protein geose Geobacillus stearothermophilus Geobacillus stearothermophilus Bacillus stearothermophilus MGVKTFQFPFAEQLEKVAEQFPTFQILNEEGEVVNEEAMPELSDEQLKELMRRMVYTRILDQRSISLNRQGRLGFYAPTAGQEASQIASHFALEKEDFILPGYRDVPQIIWHGLPLYQAFLFSRGHFHGNQIPEGVNVLPPQIIIGAQYIQAAGVALGLKMRGKKAVAITYTGDGGTSQGDFYEGINFAGAFKAPAIFVVQNNRFAISTPVEKQTVAKTLAQKAVAAGIPGIQVDGMDPLAVYAAVKAARERAINGEGPTLIETLCFRYGPHTMSGDDPTRYRSKELENEWAKKDPLVRFRKFLEAKGLWSEEEENNVIEQAKEEIKEAIKKADETPKQKVTDLISIMFEELPFNLKEQYEIYKEKESK DIP protein P21873 original sequence version: 69 DIP protein P21873 original sequence version: 56 DIP protein P21873 original sequence version: 68 DBF43982C0E1926D dldh1_geose Dihydrolipoyl dehydrogenase pdhD Dihydrolipoamide dehydrogenase E3 component of pyruvate complex protein protein geose Geobacillus stearothermophilus Geobacillus stearothermophilus Bacillus stearothermophilus MVVGDFAIETETLVVGAGPGGYVAAIRAAQLGQKVTIVEKGNLGGVCLNVGCIPSKALISASHRYEQAKHSEEMGIKAENVTIDFAKVQEWKASVVKKLTGGVEGLLKGNKVEIVKGEAYFVDANTVRVVNGDSAQTYTFKNAIIATGSRPIELPNFKFSNRILDSTGALNLGEVPKSLVVIGGGYIGIELGTAYANFGTKVTILEGAGEILSGFEKQMAAIIKKRLKKKGVEVVTNALAKGAEEREDGVTVTYEANGETKTIDADYVLVTVGRRPNTDELGLEQIGIKMTNRGLIEVDQQCRTSVPNIFAIGDIVPGPALAHKASYEGKVAAEAIAGHPSAVDYVAIPAVVFSDPECASVGYFEQQAKDEGIDVIAAKFPFAANGRALALNDTDGFLKLVVRKEDGVIIGAQIIGPNASDMIAELGLAIEAGMTAEDIALTIHAHPTLGEIAMEAAEVALGTPIHIITK DIP protein P11959 original sequence version: 81 DIP protein P11959 original sequence version: 116 C9C05F21A3EE4CB7 odpb_geose Pyruvate dehydrogenase E1 component subunit beta pdhB protein protein geose Geobacillus stearothermophilus Geobacillus stearothermophilus Bacillus stearothermophilus MAQMTMVQAITDALRIELKNDPNVLIFGEDVGVNGGVFRATEGLQAEFGEDRVFDTPLAESGIGGLAIGLALQGFRPVPEIQFFGFVYEVMDSICGQMARIRYRTGGRYHMPITIRSPFGGGVHTPELHSDSLEGLVAQQPGLKVVIPSTPYDAKGLLISAIRDNDPVIFLEHLKLYRSFRQEVPEGEYTIPIGKADIKREGKDITIIAYGAMVHESLKAAAELEKEGISAEVVDLRTVQPLDIETIIGSVEKTGRAIVVQEAQRQAGIAANVVAEINERAILSLEAPVLRVAAPDTVYPFAQAESVWLPNFKDVIETAKKVMNF DIP protein P21874 original sequence version: 73 DIP protein P21874 original sequence version: 60 DIP protein P21874 original sequence version: 72 AD1F2D4F82D652AC odp2_geose Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex pdhC E2 Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex protein protein geose Geobacillus stearothermophilus Geobacillus stearothermophilus Bacillus stearothermophilus MAFEFKLPDIGEGIHEGEIVKWFVKPGDEVNEDDVLCEVQNDKAVVEIPSPVKGKVLEILVPEGTVATVGQTLITLDAPGYENMTFKGQEQEEAKKEEKTETVSKEEKVDAVAPNAPAAEAEAGPNRRVIAMPSVRKYAREKGVDIRLVQGTGKNGRVLKEDIDAFLAGGAKPAPAAAEEKAAPAAAKPATTEGEFPETREKMSGIRRAIAKAMVHSKHTAPHVTLMDEADVTKLVAHRKKFKAIAAEKGIKLTFLPYVVKALVSALREYPVLNTSIDDETEEIIQKHYYNIGIAADTDRGLLVPVIKHADRKPIFALAQEINELAEKARDGKLTPGEMKGASCTITNIGSAGGQWFTPVINHPEVAILGIGRIAEKPIVRDGEIVAAPMLALSLSFDHRMIDGATAQKALNHIKRLLSDPELLLMEA DIP protein P11961 original sequence version: 92 DIP protein P11961 original sequence version: 77 DIP protein P11961 original sequence version: 91 DIP protein P11961 original sequence version: 114 2600CD150261ACB0 pdha-pdhb-6 4 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association pdhc-pdhd-1 3 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 8 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association pdhc-pdhd-2 5 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 8 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association pdha-pdhb-7 2 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association dlat-1 1 6 unspecified role unspecified role unspecified role unspecified role Region 320-614 Region 320-614 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction