DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu SOCS1 is an inducible host factor during HIV-1 infection and regulates the intracellular trafficking and stability of HIV-1 Gag. SOCS1 is an inducible host factor during HIV-1 infection and regulates the intracellular trafficking and stability of HIV-1 Gag. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Ryo A., Tsurutani N., Ohba K., Kimura R., Komano J., Nishi M., Soeda H., Hattori S., Perrem K., Yamamoto M., Chiba J., Mimaya J., Yoshimura K., Matsushita S., Honda M., Yoshimura A., Sawasaki T., Aoki I., Morikawa Y., Yamamoto N. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Ryo A., Tsurutani N., Ohba K., Kimura R., Komano J., Nishi M., Soeda H., Hattori S., Perrem K., Yamamoto M., Chiba J., Mimaya J., Yoshimura K., Matsushita S., Honda M., Yoshimura A., Sawasaki T., Aoki I., Morikawa Y., Yamamoto N. DIP original experiment: DIP-68202X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx SOCS1 is an inducible host factor during HIV-1 infection and regulates the intracellular trafficking and stability of HIV-1 Gag. SOCS1 is an inducible host factor during HIV-1 infection and regulates the intracellular trafficking and stability of HIV-1 Gag. SOCS1 is an inducible host factor during HIV-1 infection and regulates the intracellular trafficking and stability of HIV-1 Gag. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Ryo A., Tsurutani N., Ohba K., Kimura R., Komano J., Nishi M., Soeda H., Hattori S., Perrem K., Yamamoto M., Chiba J., Mimaya J., Yoshimura K., Matsushita S., Honda M., Yoshimura A., Sawasaki T., Aoki I., Morikawa Y., Yamamoto N. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Ryo A., Tsurutani N., Ohba K., Kimura R., Komano J., Nishi M., Soeda H., Hattori S., Perrem K., Yamamoto M., Chiba J., Mimaya J., Yoshimura K., Matsushita S., Honda M., Yoshimura A., Sawasaki T., Aoki I., Morikawa Y., Yamamoto N. DIP original experiment: DIP-68204X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx SOCS1 is an inducible host factor during HIV-1 infection and regulates the intracellular trafficking and stability of HIV-1 Gag. SOCS1 is an inducible host factor during HIV-1 infection and regulates the intracellular trafficking and stability of HIV-1 Gag. SOCS1 is an inducible host factor during HIV-1 infection and regulates the intracellular trafficking and stability of HIV-1 Gag. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Ryo A., Tsurutani N., Ohba K., Kimura R., Komano J., Nishi M., Soeda H., Hattori S., Perrem K., Yamamoto M., Chiba J., Mimaya J., Yoshimura K., Matsushita S., Honda M., Yoshimura A., Sawasaki T., Aoki I., Morikawa Y., Yamamoto N. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Ryo A., Tsurutani N., Ohba K., Kimura R., Komano J., Nishi M., Soeda H., Hattori S., Perrem K., Yamamoto M., Chiba J., Mimaya J., Yoshimura K., Matsushita S., Honda M., Yoshimura A., Sawasaki T., Aoki I., Morikawa Y., Yamamoto N. DIP original experiment: DIP-68201X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx SOCS1 is an inducible host factor during HIV-1 infection and regulates the intracellular trafficking and stability of HIV-1 Gag. SOCS1 is an inducible host factor during HIV-1 infection and regulates the intracellular trafficking and stability of HIV-1 Gag. SOCS1 is an inducible host factor during HIV-1 infection and regulates the intracellular trafficking and stability of HIV-1 Gag. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Ryo A., Tsurutani N., Ohba K., Kimura R., Komano J., Nishi M., Soeda H., Hattori S., Perrem K., Yamamoto M., Chiba J., Mimaya J., Yoshimura K., Matsushita S., Honda M., Yoshimura A., Sawasaki T., Aoki I., Morikawa Y., Yamamoto N. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Ryo A., Tsurutani N., Ohba K., Kimura R., Komano J., Nishi M., Soeda H., Hattori S., Perrem K., Yamamoto M., Chiba J., Mimaya J., Yoshimura K., Matsushita S., Honda M., Yoshimura A., Sawasaki T., Aoki I., Morikawa Y., Yamamoto N. DIP original experiment: DIP-68200X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx SOCS1 is an inducible host factor during HIV-1 infection and regulates the intracellular trafficking and stability of HIV-1 Gag. SOCS1 is an inducible host factor during HIV-1 infection and regulates the intracellular trafficking and stability of HIV-1 Gag. SOCS1 is an inducible host factor during HIV-1 infection and regulates the intracellular trafficking and stability of HIV-1 Gag. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Ryo A., Tsurutani N., Ohba K., Kimura R., Komano J., Nishi M., Soeda H., Hattori S., Perrem K., Yamamoto M., Chiba J., Mimaya J., Yoshimura K., Matsushita S., Honda M., Yoshimura A., Sawasaki T., Aoki I., Morikawa Y., Yamamoto N. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Ryo A., Tsurutani N., Ohba K., Kimura R., Komano J., Nishi M., Soeda H., Hattori S., Perrem K., Yamamoto M., Chiba J., Mimaya J., Yoshimura K., Matsushita S., Honda M., Yoshimura A., Sawasaki T., Aoki I., Morikawa Y., Yamamoto N. DIP original experiment: DIP-68203X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx SOCS1 is an inducible host factor during HIV-1 infection and regulates the intracellular trafficking and stability of HIV-1 Gag. q77yg1_9hiv1 Gag polyprotein gag protein protein 9hiv1 Human immunodeficiency virus 1 MGARASVLSGGELDRWEKIRLRPGGKKKYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTVATLYCVHQRIEIKDTKEALDKIEEEQNKSKKKAQQAAADTGHSNQVSQNYPIVQNIQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRVHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTNNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPAATLEEMMTACQGVGGPGHKARVLAEAMSQVTNSATIMMQRGNFRNQRKIVKCFNCGKEGHTARNCRAPRKKGCWKCGKEGHQMKDCTERQANFLGKIWPSYKGRPGNFLQSRPEPTAPPEESFRSGVETTTPPQKQEPIDKELYPLTSLRSLFGNDPSSQ B74C3858C20EF82C socs1_human Suppressor of cytokine signaling 1 SOCS1 SSI1 TIP3 JAK-binding protein STAT-induced STAT inhibitor 1 Tec-interacting protein 3 protein protein human Homo sapiens Human MVAHNQVAADNAVSTAAEPRRRPEPSSSSSSSPAAPARPRPCPAVPAPAPGDTHFRTFRSHADYRRITRASALLDACGFYWGPLSVHGAHERLRAEPVGTFLVRDSRQRNCFFALSVKMASGPTSIRVHFQAGRFHLDGSRESFDCLFELLEHYVAAPRRMLGAPLRQRRVRPLQELCRQRIVATVGRENLARIPLNPVLRDYLSSFPFQI DIP protein O15524 original sequence version: 59 7CC983533F78B127 gag-socs1-2 1 7 unspecified role unspecified role prey prey human Homo sapiens Human 6 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association gag-socs1-3 2 6 unspecified role unspecified role bait bait GST-tag GST-tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Binding region 2-132 Binding region 2-132 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Binding region 379-433 Binding region 379-433 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 7 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Binding region 1-176 Binding region 1-176 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human physical association physical association socs1-gag-1 4 6 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 7 unspecified role unspecified role bait bait GST-tag GST-tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association gag-socs1-4 3 7 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 6 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association socs1-gag-2 5 7 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 6 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range Binding region 2-132 Binding region 2-132 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Binding region 379-433 Binding region 379-433 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human physical association physical association