DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu CLOCK-mediated acetylation of BMAL1 controls circadian function. CLOCK-mediated acetylation of BMAL1 controls circadian function. Nature 2007 imex curation Hirayama J., Sahar S., Grimaldi B., Tamaru T., Takamatsu K., Nakahata Y., Sassone-Corsi P. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Hirayama J., Sahar S., Grimaldi B., Tamaru T., Takamatsu K., Nakahata Y., Sassone-Corsi P. DIP original experiment: DIP-255247X Nature 2007 IMEx CLOCK-mediated acetylation of BMAL1 controls circadian function. CLOCK-mediated acetylation of BMAL1 controls circadian function. CLOCK-mediated acetylation of BMAL1 controls circadian function. Nature 2007 imex curation Hirayama J., Sahar S., Grimaldi B., Tamaru T., Takamatsu K., Nakahata Y., Sassone-Corsi P. Only protein-protein interactions human Homo sapiens Human 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Hirayama J., Sahar S., Grimaldi B., Tamaru T., Takamatsu K., Nakahata Y., Sassone-Corsi P. DIP original experiment: DIP-255246X Nature 2007 IMEx CLOCK-mediated acetylation of BMAL1 controls circadian function. CLOCK-mediated acetylation of BMAL1 controls circadian function. CLOCK-mediated acetylation of BMAL1 controls circadian function. Nature 2007 imex curation Hirayama J., Sahar S., Grimaldi B., Tamaru T., Takamatsu K., Nakahata Y., Sassone-Corsi P. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Hirayama J., Sahar S., Grimaldi B., Tamaru T., Takamatsu K., Nakahata Y., Sassone-Corsi P. DIP original experiment: DIP-255245X Nature 2007 IMEx CLOCK-mediated acetylation of BMAL1 controls circadian function. CLOCK-mediated acetylation of BMAL1 controls circadian function. CLOCK-mediated acetylation of BMAL1 controls circadian function. Nature 2007 imex curation Hirayama J., Sahar S., Grimaldi B., Tamaru T., Takamatsu K., Nakahata Y., Sassone-Corsi P. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Hirayama J., Sahar S., Grimaldi B., Tamaru T., Takamatsu K., Nakahata Y., Sassone-Corsi P. DIP original experiment: DIP-255242X Nature 2007 IMEx CLOCK-mediated acetylation of BMAL1 controls circadian function. CLOCK-mediated acetylation of BMAL1 controls circadian function. CLOCK-mediated acetylation of BMAL1 controls circadian function. Nature 2007 imex curation Hirayama J., Sahar S., Grimaldi B., Tamaru T., Takamatsu K., Nakahata Y., Sassone-Corsi P. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Hirayama J., Sahar S., Grimaldi B., Tamaru T., Takamatsu K., Nakahata Y., Sassone-Corsi P. DIP original experiment: DIP-255244X Nature 2007 IMEx CLOCK-mediated acetylation of BMAL1 controls circadian function. CLOCK-mediated acetylation of BMAL1 controls circadian function. CLOCK-mediated acetylation of BMAL1 controls circadian function. Nature 2007 imex curation Hirayama J., Sahar S., Grimaldi B., Tamaru T., Takamatsu K., Nakahata Y., Sassone-Corsi P. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Hirayama J., Sahar S., Grimaldi B., Tamaru T., Takamatsu K., Nakahata Y., Sassone-Corsi P. DIP original experiment: DIP-255243X Nature 2007 IMEx CLOCK-mediated acetylation of BMAL1 controls circadian function. cry1_mouse Cryptochrome-1 Cry1 protein protein mouse Mus musculus Mouse MGVNAVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFAGSSNVGINRWRFLLQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKKLATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLVSKMEPLEMPADTITSDVIGKCMTPLSDDHDEKYGVPSLEELGFDTDGLSSAVWPGGETEALTRLERHLERKAWVANFERPRMNANSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVNHAEASRLNIERMKQIYQQLSRYRGLGLLASVPSNSNGNGGLMGYAPGENVPSCSSSGNGGLMGYAPGENVPSCSGGNCSQGSGILHYAHGDSQQTHSLKQGRSSAGTGLSSGKRPSQEEDAQSVGPKVQRQSSN DIP protein P97784 original sequence version: 119 DIP protein P97784 original sequence version: 108 DIP protein P97784 original sequence version: 86 DIP protein P97784 original sequence version: 110 DIP protein P97784 original sequence version: 113 DIP protein P97784 original sequence version: 125 DIP protein P97784 original sequence version: 130 DIP protein P97784 original sequence version: 95 2F2B8DD53F0A9AF9 bmal1_mouse Aryl hydrocarbon receptor nuclear translocator-like protein 1 Arntl Bmal1 Brain and muscle ARNT-like 1 Arnt3 protein protein mouse Mus musculus Mouse MADQRMDISSTISDFMSPGPTDLLSGSLGTSGVDCNRKRKGSATDYQLDDFAFEESMDTDKDDPHGRLEYAEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYTEANYKPTFLSDDELKHLILRAADGFLFVVGCDRGKILFVSESVFKILNYSQNDLIGQSLFDYLHPKDIAKVKEQLSSSDTAPRERLIDAKTGLPVKTDITPGPSRLCSGARRSFFCRMKCNRPSVKVEDKDFASTCSKKKDRKSFCTIHSTGYLKSWPPTKMGLDEDNEPDNEGCNLSCLVAIGRLHSHMVPQPANGEIRVKSMEYVSRHAIDGKFVFVDQRATAILAYLPQELLGTSCYEYFHQDDIGHLAECHRQVLQTREKITTNCYKFKIKDGSFITLRSRWFSFMNPWTKEVEYIVSTNTVVLANVLEGGDPTFPQLTAPPHSMDSMLPSGEGGPKRTHPTVPGIPGGTRAGAGKIGRMIAEEIMEIHRIRGSSPSSCGSSPLNITSTPPPDASSPGGKKILNGGTPDIPSTGLLPGQAQETPGYPYSDSSSILGENPHIGIDMIDNDQGSSSPSNDEAAMAVIMSLLEADAGLGGPVDFSDLPWPL DIP protein Q9WTL8 original sequence version: 134 DIP protein Q9WTL8 original sequence version: 123 DIP protein Q9WTL8 original sequence version: 94 DIP protein Q9WTL8 original sequence version: 128 DIP protein Q9WTL8 original sequence version: 144 DIP protein Q9WTL8 original sequence version: 145 9669C3712A95C2DE q9wtl8-2 Aryl hydrocarbon receptor nuclear translocator-like protein 1 b Arntl Bmal1 Arnt3 Brain and muscle ARNT-like 1 protein protein mouse Mus musculus Mouse MADQRMDISSTISDFMSPGPTDLLSGSLGTSGVDCNRKRKGSATDYQESMDTDKDDPHGRLEYAEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYTEANYKPTFLSDDELKHLILRAADGFLFVVGCDRGKILFVSESVFKILNYSQNDLIGQSLFDYLHPKDIAKVKEQLSSSDTAPRERLIDAKTGLPVKTDITPGPSRLCSGARRSFFCRMKCNRPSVKVEDKDFASTCSKKKDRKSFCTIHSTGYLKSWPPTKMGLDEDNEPDNEGCNLSCLVAIGRLHSHMVPQPANGEIRVKSMEYVSRHAIDGKFVFVDQRATAILAYLPQELLGTSCYEYFHQDDIGHLAECHRQVLQTREKITTNCYKFKIKDGSFITLRSRWFSFMNPWTKEVEYIVSTNTVVLANVLEGGDPTFPQLTAPPHSMDSMLPSGEGGPKRTHPTVPGIPGGTRAGAGKIGRMIAEEIMEIHRIRGSSPSSCGSSPLNITSTPPPDASSPGGKKILNGGTPDIPSTGLLPGQAQETPGYPYSDSSSILGENPHIGIDMIDNDQGSSSPSNDEAAMAVIMSLLEADAGLGGPVDFSDLPWPL DIP protein Q9WTL8-2 original sequence version: 123 5A99555F851260CF clock_mouse Circadian locomoter output cycles protein kaput Clock protein protein mouse Mus musculus Mouse MVFTVSCSKMSSIVDRDDSSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSMLPGNARKMDKSTVLQKSIDFLRKHKETTAQSDASEIRQDWKPTFLSNEEFTQLMLEALDGFFLAIMTDGSIIYVSESVTSLLEHLPSDLVDQSIFNFIPEGEHSEVYKILSTHLLESDSLTPEYLKSKNQLEFCCHMLRGTIDPKEPSTYEYVRFIGNFKSLTSVSTSTHNGFEGTIQRTHRPSYEDRVCFVATVRLATPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHVDDLENLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYITYHQWNSRPEFIVCTHTVVSYAEVRAERRRELGIEESLPETAADKSQDSGSDNRINTVSLKEALERFDHSPTPSASSRSSRKSSHTAVSDPSSTPTKIPTDTSTPPRQHLPAHEKMTQRRSSFSSQSINSQSVGPSLTQPAMSQAANLPIPQGMSQFQFSAQLGAMQHLKDQLEQRTRMIEANIHRQQEELRKIQEQLQMVHGQGLQMFLQQSNPGLNFGSVQLSSGNSNIQQLTPVNMQGQVVPANQVQSGHISTGQHMIQQQTLQSTSTQQSQQSVMSGHSQQTSLPSQTPSTLTAPLYNTMVISQPAAGSMVQIPSSMPQNSTQSATVTTFTQDRQIRFSQGQQLVTKLVTAPVACGAVMVPSTMLMGQVVTAYPTFATQQQQAQTLSVTQQQQQQQQQPPQQQQQQQQSSQEQQLPSVQQPAQAQLGQPPQQFLQTSRLLHGNPSTQLILSAAFPLQQSTFPPSHHQQHQPQQQQQLPRHRTDSLTDPSKVQPQ DIP protein O08785 original sequence version: 149 DIP protein O08785-1 original sequence version: 138 DIP protein O08785 original sequence version: 138 DIP protein O08785 original sequence version: 108 DIP protein O08785 original sequence version: 143 DIP protein O08785 original sequence version: 155 DIP protein O08785 original sequence version: 159 DIP protein O08785 original sequence version: 160 9864D947049742F4 cry1-arntl-3 5 7 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 10 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 9 unspecified role unspecified role prey prey VP16-tag VP16-tag vp16 ad vp16 activation domain vp16 ad undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human association association arntl-clock-9 4 10 unspecified role unspecified role prey prey mouse Mus musculus Mouse 8 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association arntl-clock-10 6 10 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 1-242 Region 1-242 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 9 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Tag used for western blot detection. human Homo sapiens Human physical association physical association cry1-arntl-4 2 7 unspecified role unspecified role bait bait human Homo sapiens Human 9 unspecified role unspecified role prey prey Q9WTL8-2:p.Lys537Arg K537R mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain K R This feature has been corrected as a result of our quality control procedures. The original label was 'K537R'. Wed May 02 20:08:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys537arg' Tue Jun 30 16:42:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys537Arg' human Homo sapiens Human physical association physical association arntl-clock-11 3 10 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 9 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Region 1-469 Region 1-469 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human physical association physical association cry1-arntl-5 1 7 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 9 unspecified role unspecified role prey prey VP16-tag VP16-tag vp16 ad vp16 activation domain vp16 ad undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9WTL8-2:p.Lys537Arg K537R mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain K R This feature has been corrected as a result of our quality control procedures. The original label was 'K537R'. Wed May 02 19:32:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys537arg' Tue Jun 30 17:09:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys537Arg' human Homo sapiens Human physical association physical association