IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Human leukocyte antigen-B-associated transcript 3 is released from tumor cells and engages the NKp30 receptor on natural killer cells. Human leukocyte antigen-B-associated transcript 3 is released from tumor cells and engages the NKp30 receptor on natural killer cells. Immunity 2007 imex curation Pogge von Strandmann E., Simhadri VR., von Tresckow B., Sasse S., Reiners KS., Hansen HP., Rothe A., Böll B., Simhadri VL., Borchmann P., McKinnon PJ., Hallek M., Engert A., Pogge von Strandmann E., Simhadri VR., von Tresckow B., Sasse S., Reiners KS., Hansen HP., Rothe A., Böll B., Simhadri VL., Borchmann P., McKinnon PJ., Hallek M., Engert A. elke.pogge@uk-koeln.de 14-Jul-2017: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Pogge von Strandmann E., Simhadri VR., von Tresckow B., Sasse S., Reiners KS., Hansen HP., Rothe A., Böll B., Simhadri VL., Borchmann P., McKinnon PJ., Hallek M., Engert A., Pogge von Strandmann E., Simhadri VR., von Tresckow B., Sasse S., Reiners KS., Hansen HP., Rothe A., Böll B., Simhadri VL., Borchmann P., McKinnon PJ., Hallek M., Engert A. elke.pogge@uk-koeln.de Accepted 2017-JUN-07 AT 13:10 BST AT 13:10 BST by ORCHARD Immunity 2007 imex curation Human leukocyte antigen-B-associated transcript 3 is released from tumor cells and engages the NKp30 receptor on natural killer cells. Human leukocyte antigen-B-associated transcript 3 is released from tumor cells and engages the NKp30 receptor on natural killer cells. Immunity 2007 imex curation Pogge von Strandmann E., Simhadri VR., von Tresckow B., Sasse S., Reiners KS., Hansen HP., Rothe A., Böll B., Simhadri VL., Borchmann P., McKinnon PJ., Hallek M., Engert A., Pogge von Strandmann E., Simhadri VR., von Tresckow B., Sasse S., Reiners KS., Hansen HP., Rothe A., Böll B., Simhadri VL., Borchmann P., McKinnon PJ., Hallek M., Engert A. elke.pogge@uk-koeln.de 14-Jul-2017: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom anti tag western anti tag western blot anti tag western Pogge von Strandmann E., Simhadri VR., von Tresckow B., Sasse S., Reiners KS., Hansen HP., Rothe A., Böll B., Simhadri VL., Borchmann P., McKinnon PJ., Hallek M., Engert A., Pogge von Strandmann E., Simhadri VR., von Tresckow B., Sasse S., Reiners KS., Hansen HP., Rothe A., Böll B., Simhadri VL., Borchmann P., McKinnon PJ., Hallek M., Engert A. elke.pogge@uk-koeln.de Accepted 2017-JUN-07 AT 13:10 BST AT 13:10 BST by ORCHARD Immunity 2007 imex curation Human leukocyte antigen-B-associated transcript 3 is released from tumor cells and engages the NKp30 receptor on natural killer cells. Human leukocyte antigen-B-associated transcript 3 is released from tumor cells and engages the NKp30 receptor on natural killer cells. Immunity 2007 imex curation Pogge von Strandmann E., Simhadri VR., von Tresckow B., Sasse S., Reiners KS., Hansen HP., Rothe A., Böll B., Simhadri VL., Borchmann P., McKinnon PJ., Hallek M., Engert A., Pogge von Strandmann E., Simhadri VR., von Tresckow B., Sasse S., Reiners KS., Hansen HP., Rothe A., Böll B., Simhadri VL., Borchmann P., McKinnon PJ., Hallek M., Engert A. elke.pogge@uk-koeln.de 14-Jul-2017: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Pogge von Strandmann E., Simhadri VR., von Tresckow B., Sasse S., Reiners KS., Hansen HP., Rothe A., Böll B., Simhadri VL., Borchmann P., McKinnon PJ., Hallek M., Engert A., Pogge von Strandmann E., Simhadri VR., von Tresckow B., Sasse S., Reiners KS., Hansen HP., Rothe A., Böll B., Simhadri VL., Borchmann P., McKinnon PJ., Hallek M., Engert A. elke.pogge@uk-koeln.de Accepted 2017-JUN-07 AT 13:10 BST AT 13:10 BST by ORCHARD Immunity 2007 imex curation Human leukocyte antigen-B-associated transcript 3 is released from tumor cells and engages the NKp30 receptor on natural killer cells. Human leukocyte antigen-B-associated transcript 3 is released from tumor cells and engages the NKp30 receptor on natural killer cells. Immunity 2007 imex curation Pogge von Strandmann E., Simhadri VR., von Tresckow B., Sasse S., Reiners KS., Hansen HP., Rothe A., Böll B., Simhadri VL., Borchmann P., McKinnon PJ., Hallek M., Engert A., Pogge von Strandmann E., Simhadri VR., von Tresckow B., Sasse S., Reiners KS., Hansen HP., Rothe A., Böll B., Simhadri VL., Borchmann P., McKinnon PJ., Hallek M., Engert A. elke.pogge@uk-koeln.de 14-Jul-2017: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Pogge von Strandmann E., Simhadri VR., von Tresckow B., Sasse S., Reiners KS., Hansen HP., Rothe A., Böll B., Simhadri VL., Borchmann P., McKinnon PJ., Hallek M., Engert A., Pogge von Strandmann E., Simhadri VR., von Tresckow B., Sasse S., Reiners KS., Hansen HP., Rothe A., Böll B., Simhadri VL., Borchmann P., McKinnon PJ., Hallek M., Engert A. elke.pogge@uk-koeln.de Accepted 2017-JUN-07 AT 13:10 BST AT 13:10 BST by ORCHARD K562-derived cDNA library Immunity 2007 imex curation p46379-1 Large proline-rich protein BAG6 BAG6 BAG family molecular chaperone regulator 6 BAT3 BCL2-associated athanogene 6 G3 HLA-B-associated transcript 3 Protein G3 Protein Scythe protein protein human Homo sapiens Human MEPNDSTSTAVEEPDSLEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGKVIHLVERAPPQTHLPSGASSGTGSASATHGGGSPPGTRGPGASVHDRNANSYVMVGTFNLPSDGSAVDVHINMEQAPIQSEPRVRLVMAQHMIRDIQTLLSRMETLPYLQCRGGPQPQHSQPPPQPPAVTPEPVALSSQTSEPVESEAPPREPMEAEEVEERAPAQNPELTPGPAPAGPTPAPETNAPNHPSPAEYVEVLQELQRLESRLQPFLQRYYEVLGAAATTDYNNNHEGREEDQRLINLVGESLRLLGNTFVALSDLRCNLACTPPRHLHVVRPMSHYTTPMVLQQAAIPIQINVGTTVTMTGNGTRPPPTPNAEAPPPGPGQASSVAPSSTNVESSAEGAPPPGPAPPPATSHPRVIRISHQSVEPVVMMHMNIQDSGTQPGGVPSAPTGPLGPPGHGQTLGQQVPGFPTAPTRVVIARPTPPQARPSHPGGPPVSGTLQGAGLGTNASLAQMVSGLVGQLLMQPVLVAQGTPGMAPPPAPATASASAGTTNTATTAGPAPGGPAQPPPTPQPSMADLQFSQLLGNLLGPAGPGAGGSGVASPTITVAMPGVPAFLQGMTDFLQATQTAPPPPPPPPPPPPAPEQQTMPPPGSPSGGAGSPGGLGLESLSPEFFTSVVQGVLSSLLGSLGARAGSSESIAAFIQRLSGSSNIFEPGADGALGFFGALLSLLCQNFSMVDVVMLLHGHFQPLQRLQPQLRSFFHQHYLGGQEPTPSNIRMATHTLITGLEEYVRESFSLVQVQPGVDIIRTNLEFLQEQFNSIAAHVLHCTDSGFGARLLELCNQGLFECLALNLHCLGGQQMELAAVINGRIRRMSRGVNPSLVSWLTTMMGLRLQVVLEHMPVGPDAILRYVRRVGDPPQPLPEEPMEVQGAERASPEPQRENASPAPGTTAEEAMSRGPPPAPEGGSRDEQDGASAETEPWAAAVPPEWVPIIQQDIQSQRKVKPQPPLSDAYLSGMPAKRRKTMQGEGPQLLLSEAVSRAAKAAGARPLTSPESLSRDLEAPEVQESYRQQLRSDIQKRLQEDPNYSPQRFPNAQRAFADDP 625B5F86321367ED o14931-1 Natural cytotoxicity triggering receptor 3 NCR3 1C7 LY117 Activating natural killer receptor p30 Natural killer cell p30-related protein 1C7a protein protein human Homo sapiens Human MAWMLLLILIMVHPGSCALWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGTVLLLRAGFYAVSFLSVAVGSTVYYQGKCLTWKGPRRQLPAVVPAPLPPPCGSSAHLLPPVPGG 2855AE4D6902D429 ncr3-bag6-5 4 5 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role bait bait signal sequence+ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 9 11 physical association physical association none To identify proteins interacting with NKp30, a fusion construct consisting of the GAL4-DNA-binding domain and the extracellular NKp30 sequence (GBT9-NKp30) was used as bait. We screened a K562-derived cDNA library and isolated a clone encoding the C-terminal sequence of BAT3 (BAT3-CT). ncr3-bag6-1 1 5 unspecified role unspecified role prey prey region_minus_BAG_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role bait bait signal sequence+ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Supp figure 1A bag6-bag6-1 1 5 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 21 19 physical association physical association Supp figure 1A-2 ncr3-bag6-2 2 5 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 6 unspecified role unspecified role bait bait ecd sufficient to bind sufficient binding region sufficient to bind range range range range human IgG1 kappa signal sequence tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c_terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 24 27 physical association physical association Fig 1 The direct and specific binding of NKp30 to BAT3 was confirmed by coimmunoprecipitation ncr3-bag6-3 3 5 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 6 unspecified role unspecified role bait bait ecd sufficient to bind sufficient binding region sufficient to bind range range range range human IgG1 kappa signal sequence tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c_terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 35 32 physical association physical association Fig 3 C/D/G We screened a K562-derived cDNA library and isolated a clone encoding the C-terminal sequence of BAT3 (BAT3-CT) Blocking of NKp30 by pp65 (UL83 -HCMV) did not interfere with BAT3 binding to plate-bound NKp30-Ig.