DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Novel roles of formin mDia2 in lamellipodia and filopodia formation in motile cells. Novel roles of formin mDia2 in lamellipodia and filopodia formation in motile cells. PLoS biology 2007 imex curation Yang C., Czech L., Gerboth S., Kojima S., Scita G., Svitkina T. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Yang C., Czech L., Gerboth S., Kojima S., Scita G., Svitkina T. DIP original experiment: DIP-67876X PLoS biology 2007 IMEx Novel roles of formin mDia2 in lamellipodia and filopodia formation in motile cells. Novel roles of formin mDia2 in lamellipodia and filopodia formation in motile cells. Novel roles of formin mDia2 in lamellipodia and filopodia formation in motile cells. PLoS biology 2007 imex curation Yang C., Czech L., Gerboth S., Kojima S., Scita G., Svitkina T. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yang C., Czech L., Gerboth S., Kojima S., Scita G., Svitkina T. DIP original experiment: DIP-67875X PLoS biology 2007 IMEx Novel roles of formin mDia2 in lamellipodia and filopodia formation in motile cells. Novel roles of formin mDia2 in lamellipodia and filopodia formation in motile cells. Novel roles of formin mDia2 in lamellipodia and filopodia formation in motile cells. PLoS biology 2007 imex curation Yang C., Czech L., Gerboth S., Kojima S., Scita G., Svitkina T. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Yang C., Czech L., Gerboth S., Kojima S., Scita G., Svitkina T. DIP original experiment: DIP-67874X PLoS biology 2007 IMEx Novel roles of formin mDia2 in lamellipodia and filopodia formation in motile cells. abi1_mouse Abl interactor 1 Abi1 Ssh3bp1 Abelson interactor 1 Spectrin SH3 domain-binding protein 1 Eps8 SH3 domain-binding protein e3B1 Ablphilin-1 protein protein mouse Mus musculus Mouse MAELQMLLEEEIPSGKRALIESYQNLTRVADYCENNYIQATDKRKALEETKAYTTQSLASVAYQINALANNVLQLLDIQASQLRRMESSINHISQTVDIHKEKVARREIGILTTNKNTSRTHKIIAPANMERPVRYIRKPIDYTVLDDVGHGVKWLKAKHGNNQPARTGTLSRTNPPTQKPPSPPVSGRGTLGRNTPYKTLEPVKPPTVPNDYMTSPARLGSQHSPGRTASLNQRPRTHSGSSGGSGSRENSGSSSIGIPIAVPTPSPPTAGPAAPGAAPGSQYGTMTRQISRHNSTTSSTSSGGYRRTPSVAAQFSAQPHVNGGPLYSQNSISVAPPPPPMPQLTPQIPLTGFVARVQENIADSPTPPPPPPPDDIPMFDDSPPPPPPPPVDYEDEEAAVVQYSDPYADGDPAWAPKNYIEKVVAIYDYTKDKDDELSFKEGAIIYVIKKNDDGWFEGVCNRVTGLFPGNYVESIMHYTD DIP protein Q8CBW3 original sequence version: 56 DIP protein Q8CBW3 original sequence version: 87 1654A1E89438BC1D wasf2_mouse Wiskott-Aldrich syndrome protein family member 2 Protein WAVE-2 Wave2 Wasf2 protein protein mouse Mus musculus Mouse MPLVTRNIEPRHLCRQTLPSDTSELECRTNITLANVIRQLGSLSKYAEDIFGEICTQASAFASRVNSLAERVDRVQVKVTQLDPKEEEVSLQGINTRKAFRSSTTQDQKLFDRNSLPVPVLETYNSCDAPPPLNNLSPYRDDGKEALKFYTNPSYFFDLWKEKMLQDTKDIMKEKRKHRKEKKDNPNRGNVNPRKIKTRKEEWEKMKMGQEFVESKERLGPSGYSSTLVYQNGSIGSVENVDAASYPPPPQSDSASSPSPSFSEDNLPPPPAEFSYPADNQRGSVLAGPKRTSMVSPSHPPPAPPLSSPPGPKPGFAPPPAPPPPPPMSVPPPLPSMGFGSPGTPPPPSPPSFPPHPDFAAPPPPPPPPAADYPMPPPPLSQPSGGAPPPPPPPPPPGPPPLPFSGADGQPAAPPPPPPSEATKPKSSLPAVSDARSDLLSAIRQGFQLRRVEEQREQEKRDVVGNDVATILSRRIAVEYSDSEDDSSEFDEDDWSD DIP protein Q8BH43 original sequence version: 41 4F970D0577792503 diap3_mouse Protein diaphanous homolog 3 Diaph3 Diap3 Diaphanous-related formin-3 p134mDIA2 protein protein mouse Mus musculus Mouse MERHRARALGRDSKSSRRKGLQSAPPAGPYEPGEKRPKLHLNIRTLTDDMLDKFASIRIPGSKKERPPLPHLKTVSGISDSSSLSSETMENNPKALPESEVLKLFEKMMEDMNLNEDKKAPLREKDFGIKKEMVMQYINTASKTGSLRSSRQISPQEFLHELKMGYTDERLFTYLESLRVSLTSHPVSWVQSFGHEGLGLLLDILEKLINGQIQEKVVKKTQHKVIQCLRALMNTQYGLERIMSDKRSLSLLAKAMDPRQPAMMADVVKLLSAVCIVGEESILEEVLEALTSAGEERKIDRFFSIVEGLRHNSVNLQVACMQLINALVTSPDDLDFRLHLRNEFMRCGLKEILPNLKGIKNDGLDIQLKVFDEHKEEDLSEFFHRLEDIRAELDEASDVYSMLWDTVKETRAEGHFLSILQHLLLIRNDRFIREQYFKLIDECVSQIVLHRDGTDPDFTYRKRLDLDLSQFVDVCIDQAKLDEWEEKASEHCKKFEKECTDHQETQAQLQKREAKINELQAELQAFKSQFGALPPGTKIPLQPSVEGEAGPSALPPAPPALSGGVPPPPPPPPPPPPPLPGMPMPFGGPVPPPPPLGFLGGQSSIPLNLPFGLKPKKEFKPEISMRRLNWLKIGPNEMSENCFWIKVNENKYENRDLLCKLENTFCCQEKEKRNTNDFDEKKVIKKRMKELKFLDPKIAQNLSIFLSSFRVPYEKIRTMILEVDETQLSESMIQNLIKHLPDEEQLKSLSQFRSDYNSLCEPEQFAVVMSNVKRLRPRLSAILFKLQFEEQVNNIKPDIMAVSTACEEIKKSKGFSKLLELVLLMGNYMNAGSRNAQTFGFDLSSLCKLKDTKSADQKTTLLHFLVDVCEEKHADILHFVDDLAHLDKASRVSVEMLEKNVKQMGRQLQQLEKNLETFPPPEDLHDKFVIKMSSFVISANEQYEKLSTLLGSMTQLYQSIMGYYAVDMKKVSVEEFFNDLNNFRTSFMLALKENIKKREAAEKEKRARIAKERAEKERLERQQEKKRLLEMKTEGDETGVMDSLLEALQSGAAFRDRRKRTPKLKDIRQSLSPMSQRPVLKVCNHENQKMQLTEGSRPHHSINCNSTRTPVAKELNYNLDTHASTGRIKAVEKEACNAESNKKKEMELLGSVAKSESVPEVEALLARLRAL DIP protein Q9Z207 original sequence version: 53 95347A854CABC7CF wasf2-abi1-1 2 5 unspecified role unspecified role bait bait human Homo sapiens Human 4 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association abi1-diaph3-1 3 4 unspecified role unspecified role bait bait human Homo sapiens Human 6 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association abi1-diaph3-2 1 4 unspecified role unspecified role bait bait SH3 domain 419-478 SH3 domain 419-478 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 6 unspecified role unspecified role prey prey Binding region 1-550 Binding region 1-550 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association