DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu A SNARE-adaptor interaction is a new mode of cargo recognition in clathrin-coated vesicles. A SNARE-adaptor interaction is a new mode of cargo recognition in clathrin-coated vesicles. Nature 2007 imex curation Miller SE., Collins BM., McCoy AJ., Robinson MS., Owen DJ. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Miller SE., Collins BM., McCoy AJ., Robinson MS., Owen DJ. DIP original experiment: DIP-255261X Nature 2007 IMEx A SNARE-adaptor interaction is a new mode of cargo recognition in clathrin-coated vesicles. A SNARE-adaptor interaction is a new mode of cargo recognition in clathrin-coated vesicles. A SNARE-adaptor interaction is a new mode of cargo recognition in clathrin-coated vesicles. Nature 2007 imex curation Miller SE., Collins BM., McCoy AJ., Robinson MS., Owen DJ. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Miller SE., Collins BM., McCoy AJ., Robinson MS., Owen DJ. DIP original experiment: DIP-255263X Nature 2007 IMEx A SNARE-adaptor interaction is a new mode of cargo recognition in clathrin-coated vesicles. A SNARE-adaptor interaction is a new mode of cargo recognition in clathrin-coated vesicles. A SNARE-adaptor interaction is a new mode of cargo recognition in clathrin-coated vesicles. Nature 2007 imex curation Miller SE., Collins BM., McCoy AJ., Robinson MS., Owen DJ. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Miller SE., Collins BM., McCoy AJ., Robinson MS., Owen DJ. DIP original experiment: DIP-255265X Nature 2007 IMEx A SNARE-adaptor interaction is a new mode of cargo recognition in clathrin-coated vesicles. A SNARE-adaptor interaction is a new mode of cargo recognition in clathrin-coated vesicles. A SNARE-adaptor interaction is a new mode of cargo recognition in clathrin-coated vesicles. Nature 2007 imex curation Miller SE., Collins BM., McCoy AJ., Robinson MS., Owen DJ. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Miller SE., Collins BM., McCoy AJ., Robinson MS., Owen DJ. DIP original experiment: DIP-255264X Nature 2007 IMEx A SNARE-adaptor interaction is a new mode of cargo recognition in clathrin-coated vesicles. A SNARE-adaptor interaction is a new mode of cargo recognition in clathrin-coated vesicles. A SNARE-adaptor interaction is a new mode of cargo recognition in clathrin-coated vesicles. Nature 2007 imex curation Miller SE., Collins BM., McCoy AJ., Robinson MS., Owen DJ. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Miller SE., Collins BM., McCoy AJ., Robinson MS., Owen DJ. DIP original experiment: DIP-255260X Nature 2007 IMEx A SNARE-adaptor interaction is a new mode of cargo recognition in clathrin-coated vesicles. A SNARE-adaptor interaction is a new mode of cargo recognition in clathrin-coated vesicles. A SNARE-adaptor interaction is a new mode of cargo recognition in clathrin-coated vesicles. Nature 2007 imex curation Miller SE., Collins BM., McCoy AJ., Robinson MS., Owen DJ. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Miller SE., Collins BM., McCoy AJ., Robinson MS., Owen DJ. DIP original experiment: DIP-255262X Nature 2007 IMEx A SNARE-adaptor interaction is a new mode of cargo recognition in clathrin-coated vesicles. A SNARE-adaptor interaction is a new mode of cargo recognition in clathrin-coated vesicles. A SNARE-adaptor interaction is a new mode of cargo recognition in clathrin-coated vesicles. Nature 2007 imex curation Miller SE., Collins BM., McCoy AJ., Robinson MS., Owen DJ. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Miller SE., Collins BM., McCoy AJ., Robinson MS., Owen DJ. DIP original experiment: DIP-255259X Nature 2007 IMEx A SNARE-adaptor interaction is a new mode of cargo recognition in clathrin-coated vesicles. stx7_human Syntaxin-7 STX7 protein protein human Homo sapiens Human MSYTPGVGGDPAQLAQRISSNIQKITQCSVEIQRTLNQLGTPQDSPELRQQLQQKQQYTNQLAKETDKYIKEFGSLPTTPSEQRQRKIQKDRLVAEFTTSLTNFQKVQRQAAEREKEFVARVRASSRVSGSFPEDSSKERNLVSWESQTQPQVQVQDEEITEDDLRLIHERESSIRQLEADIMDINEIFKDLGMMIHEQGDVIDSIEANVENAEVHVQQANQQLSRAADYQRKSRKTLCIIILILVIGVAIISLIIWGLNH DIP protein O15400 original sequence version: 123 DIP protein O15400 original sequence version: 116 42AC173F0233ACDA vti1_yeast t-SNARE VTI1 VTI1 Qb-SNARE VTI1 Vesicle transport v-SNARE protein VTI1 VPS10-interacting protein 1 YM9646.10C YMR197C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSLLISYESDFKTTLEQAKASLAEAPSQPLSQRNTTLKHVEQQQDELFDLLDQMDVEVNNSIGDASERATYKAKLREWKKTIQSDIKRPLQSLVDSGDRDRLFGDLNASNIDDDQRQQLLSNHAILQKSGDRLKDASRIANETEGIGSQIMMDLRSQRETLENARQTLFQADSYVDKSIKTLKTMTRRLVANKFISYAIIAVLILLILLVLFSKFK E55B4DA3B40FAD67 E55B4DA3B40FAD67 vamp8_human Vesicle-associated membrane protein 8 Endobrevin VAMP8 protein protein human Homo sapiens Human MEEASEGGGNDRVRNLQSEVEGVKNIMTQNVERILARGENLEHLRNKTEDLEATSEHFKTTSQKVARKFWWKNVKMIVLICVIVFIIILFIVLFATGAFS DIP protein Q9BV40 original sequence version: 108 DIP protein Q9BV40 original sequence version: 118 DIP protein Q9BV40 original sequence version: 100 018B986442BBD9B6 stx8_human Syntaxin-8 STX8 protein protein human Homo sapiens Human MAPDPWFSTYDSTCQIAQEIAEKIQQRNQYERKGEKAPKLTVTIRALLQNLKEKIALLKDLLLRAVSTHQITQLEGDRRQNLLDDLVTRERLLLASFKNEGAEPDLIRSSLMSEEAKRGAPNPWLFEEPEETRGLGFDEIRQQQQKIIQEQDAGLDALSSIISRQKQMGQEIGNELDEQNEIIDDLANLVENTDEKLRNETRRVNMVDRKSASCGMIMVILLLLVAIVVVAVWPTN DIP protein Q9UNK0 original sequence version: 153 DIP protein Q9UNK0 original sequence version: 119 DIP protein Q9UNK0 original sequence version: 100 DIP protein Q9UNK0 original sequence version: 114 1E64A0DA77584CC4 epn4_human Clathrin interactor 1 CLINT1 ENTH EPN4 EPNR KIAA0171 Epsin-4 Epsin-related protein Enthoprotin Clathrin-interacting protein localized in the trans-Golgi region protein protein human Homo sapiens Human MLNMWKVRELVDKATNVVMNYSEIESKVREATNDDPWGPSGQLMGEIAKATFMYEQFPELMNMLWSRMLKDNKKNWRRVYKSLLLLAYLIRNGSERVVTSAREHIYDLRSLENYHFVDEHGKDQGINIRQKVKELVEFAQDDDRLREERKKAKKNKDKYVGVSSDSVGGFRYSERYDPEPKSKWDEEWDKNKSAFPFSDKLGELSDKIGSTIDDTISKFRRKDREDSPERCSDSDEEKKARRGRSPKGEFKDEEETVTTKHIHITQATETTTTRHKRTANPSKTIDLGAAAHYTGDKASPDQNASTHTPQSSVKTSVPSSKSSGDLVDLFDGTSQSTGGSADLFGGFADFGSAAASGSFPSQVTATSGNGDFGDWSAFNQAPSGPVASSGEFFGSASQPAVELVSGSQSALGPPPAASNSSDLFDLMGSSQATMTSSQSMNFSMMSTNTVGLGLPMSRSQNTDMVQKSVSKTLPSTWSDPSVNISLDNLLPGMQPSKPQQPSLNTMIQQQNMQQPMNVMTQSFGAVNLSSPSNMLPVRPQTNALIGGPMPMSMPNVMTGTMGMAPLGNTPMMNQSMMGMNMNIGMSAAGMGLTGTMGMGMPNIAMTSGTVQPKQDAFANFANFSK DIP protein Q14677 original sequence version: 132 6C8C6689861E9F0D vti1b_mouse Vesicle transport through interaction with t-SNAREs homolog 1B Vesicle transport v-SNARE protein Vti1-like 1 Vti1-rp1 Vti1b Vti1l1 protein protein mouse Mus musculus Mouse MAASAASSEHFEKLHEIFRGLLEDLQGVPERLLGTAGTEEKKKLVRDFDENQQEANETLAEMEEELRYAPLTFRNPMMSKLRNYRKDLAKLHREVRSTPLTAAPGGRGDLKYGTYTLENEHLNRLQSQRALLLQGTESLNRATQSIERSHRIATETDQIGTEIIEELGEQRDQLERTKSRLVNTNENLSKSRKILRSMSRKVITNKLLLSVIILLELAILVGLVYYKFFRHH DIP protein O88384 original sequence version: 97 DIP protein O88384 original sequence version: 87 DIP protein O88384 original sequence version: 92 6827DCAF9650DFC6 ent3_yeast Epsin-3 ENT3 J2048 YJR125C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSLEDTLANMSLYDAKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFRRFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRNSINLIRILETFHYIDSQGRDQGINVRTRVKALIELLSDDNKIRAERKKARETAKKYKGVAGGSASADGSLNSKAGFTSTKVHGISVSADFDSDNEDNEDGSFSQNGYNDNASRATSTPGQGKQEPEDFVDFFSSESSKPSKELIQEDEKKADEEEDDDDEFSEFQSAVPVTNPANSFNLLNTSPIEGMPATTSSMPFYNSSTTDQGKITPAIAEPKKVDPFSSLFSTAKASAEAPSAPKASQAKAAASNPVSNSTTALSTDQDDDDEFGEMHGGAVQQEQNTNNNHTSSKEIDLLSF D666ECB1C0D074FE D666ECB1C0D074FE vti1b-clint1-1 2 13 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 1-96 Region 1-96 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 12 unspecified role unspecified role prey prey Region 1-166 Region 1-166 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q14677:p.Phe52Asp F52D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain F D This feature has been corrected as a result of our quality control procedures. The original label was 'F52D'. Wed May 02 17:40:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe52asp' Tue Jun 30 17:14:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe52Asp' Q14677:p.[Met53Asp;Tyr54Asp] M53D/Y54D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain Y D certain certain sequence position certain certain certain sequence position certain M D This feature has been corrected as a result of our quality control procedures. The original label was 'M53D/Y54D'. Wed May 02 16:03:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met53asp,tyr54asp' Tue Jun 30 16:34:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Met53Asp;Tyr54Asp]' Q14677:p.Arg96Ser R96S mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain R S This feature has been corrected as a result of our quality control procedures. The original label was 'R96S'. Wed May 02 17:05:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg96ser' Tue Jun 30 18:15:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg96Ser' Q14677:p.Arg146Glu R146E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain R E This feature has been corrected as a result of our quality control procedures. The original label was 'R146E'. Wed May 02 15:11:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg146glu' Tue Jun 30 18:36:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg146Glu' Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli direct interaction direct interaction vti1b-clint1-2 7 13 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 11 unspecified role unspecified role prey prey Region 149-213 Region 149-213 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 8 unspecified role unspecified role prey prey Region 169-237 Region 169-237 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 12 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Region 1-166 Region 1-166 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 10 unspecified role unspecified role prey prey Region 1-76 Region 1-76 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli association association clint1-vti1b-1 5 13 unspecified role unspecified role unspecified role unspecified role Region 1-96 Region 1-96 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 12 unspecified role unspecified role unspecified role unspecified role Region 20-166 Region 20-166 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction vti1p-ent3p-1 4 14 unspecified role unspecified role prey prey Region 1-174 Region 1-174 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli 9 unspecified role unspecified role bait bait Region 1-86 Region 1-86 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction vti1b-clint1-3 6 13 unspecified role unspecified role bait bait Region 1-96 Region 1-96 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain O88384:p.Ser8Trp S8W mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain S W This feature has been corrected as a result of our quality control procedures. The original label was 'S8W'. Wed May 02 20:12:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser8trp' Tue Jun 30 17:39:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser8Trp' O88384:p.Glu12Ala E12A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain E A This feature has been corrected as a result of our quality control procedures. The original label was 'E12A'. Wed May 02 17:04:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu12ala' Tue Jun 30 16:04:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu12Ala' O88384:p.Glu65Trp E65W mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain E W This feature has been corrected as a result of our quality control procedures. The original label was 'E65W'. Wed May 02 14:59:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu65trp' Tue Jun 30 17:47:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu65Trp' O88384:p.Phe73Ser F73S mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain F S This feature has been corrected as a result of our quality control procedures. The original label was 'F73S'. Wed May 02 17:30:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe73ser' Tue Jun 30 17:24:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe73Ser' O88384:p.Glu23Arg E23R mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain E R This feature has been corrected as a result of our quality control procedures. The original label was 'E23R'. Wed May 02 18:36:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu23arg' Tue Jun 30 15:53:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu23Arg' GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 12 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Region 1-166 Region 1-166 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction clint1-vti1b-2 1 13 unspecified role unspecified role unspecified role unspecified role Region 1-96 Region 1-96 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 12 unspecified role unspecified role unspecified role unspecified role Region 20-166 Region 20-166 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q14677:p.Phe52Asp F52D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain F D This feature has been corrected as a result of our quality control procedures. The original label was 'F52D'. Wed May 02 17:35:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe52asp' Tue Jun 30 17:44:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe52Asp' ecolx Escherichia coli direct interaction direct interaction clint1-vti1b-3 3 13 unspecified role unspecified role unspecified role unspecified role Region 1-96 Region 1-96 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain O88384:p.Phe73Ser F73S mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain F S This feature has been corrected as a result of our quality control procedures. The original label was 'F73S'. Wed May 02 19:13:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe73ser' Tue Jun 30 17:11:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe73Ser' O88384:p.Glu12Ala E12A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain E A This feature has been corrected as a result of our quality control procedures. The original label was 'E12A'. Wed May 02 18:44:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu12ala' Tue Jun 30 16:33:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu12Ala' ecolx Escherichia coli 12 unspecified role unspecified role unspecified role unspecified role Region 20-166 Region 20-166 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction