DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structure of an archaeal heterotrimeric initiation factor 2 reveals a nucleotide state between the GTP and the GDP states. Structure of an archaeal heterotrimeric initiation factor 2 reveals a nucleotide state between the GTP and the GDP states. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Yatime L., Mechulam Y., Blanquet S., Schmitt E. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Yatime L., Mechulam Y., Blanquet S., Schmitt E. DIP original experiment: DIP-111324X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structure of an archaeal heterotrimeric initiation factor 2 reveals a nucleotide state between the GTP and the GDP states. if2b_sacs2 Translation initiation factor 2 subunit beta eif2b aIF2-beta aif2b eIF-2-beta SSO2381 protein protein sulso Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) MSSEKEYVEMLDRLYSKLPEKGRKEGTQSLPNMIILNIGNTTIIRNFAEYCDRIRREDKICMKYLLKELAAPGNVDDKGELVIQGKFSSQVINTLMERFLKAYVECSTCKSLDTILKKEKKSWYIVCLACGAQTPVKPL A5C60230FDAE921C A5C60230FDAE921C if2a_sacs2 Translation initiation factor 2 subunit alpha eif2a aIF2-alpha aif2a eIF-2-alpha SSO1050 protein protein sulso Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) MIYSRSKLPSEGEILIATVKQVFDYGSYVSLDEYGGLQAFLPWSEVSSKWVKNIRDVLKENRKVIVKVIRVDRRKGTVDVSLKKVTDDERRKKNLQWKKIQRLDKILELVSQKLKLSEKDAWEQVAWKLEAKYGDPITAIEKAVKEGEKILIDAGVPEIWVKPLLEEASKHAEERKVKMSGLITVRTNEPLGVEKIKEVISKALENIEQDYESLLNIKIYTIGAPRYRVDVVGTNPKEASEALNQIISNLIKIGKEENVDISVVKK A94E66BBE2931272 A94E66BBE2931272 if2g_sacs2 Translation initiation factor 2 subunit gamma eif2g aIF2-gamma eIF-2-gamma SSO0412 protein protein sulso Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) MAWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI 74A1F3C850D2D3D2 74A1F3C850D2D3D2 eif2a-eif2b-1 1 4 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 2 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 3 unspecified role unspecified role unspecified role unspecified role Region 175-265 Region 175-265 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association