DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu B1500, a small membrane protein, connects the two-component systems EvgS/EvgA and PhoQ/PhoP in Escherichia coli. B1500, a small membrane protein, connects the two-component systems EvgS/EvgA and PhoQ/PhoP in Escherichia coli. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Eguchi Y., Itou J., Yamane M., Demizu R., Yamato F., Okada A., Mori H., Kato A., Utsumi R. Only protein-protein interactions ecolx Escherichia coli adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined Eguchi Y., Itou J., Yamane M., Demizu R., Yamato F., Okada A., Mori H., Kato A., Utsumi R. DIP original experiment: DIP-111320X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx B1500, a small membrane protein, connects the two-component systems EvgS/EvgA and PhoQ/PhoP in Escherichia coli. safa_ecoli Two-component-system connector protein SafA safA Regulatory protein b1500 Sensor associating factor A yneN JW1494.1 b1500 protein protein ecoli Escherichia coli (strain K12) MHATTVKNKITQRDNYKEIMSAIVVVLLLTLTLIAIFSAIDQLSISEMGRIARDLTHFIINSLQG 10ECD1B9EE15463E a1z2s2_ecolx Histidine kinase phoQ protein protein ecolx Escherichia coli MYQRKGVNISLDISPEISFVGEQNDFVEVMGNVLDNACKYCLEFVEISARQTDEHLYIVVEDDGPGIPLSKREVIFDRGQRVDTLRPGQGVGLAVAREITKQYEGKIVAGESMLGGARMEVIFGRQHSTPKDE DIP protein A1Z2S2 original sequence version: 13 b1500-phoq-1 1 3 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 2 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction