DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural basis for recruitment of mitochondrial fission complexes by Fis1. Structural basis for recruitment of mitochondrial fission complexes by Fis1. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Zhang Y., Chan DC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zhang Y., Chan DC. DIP original experiment: DIP-111316X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structural basis for recruitment of mitochondrial fission complexes by Fis1. Structural basis for recruitment of mitochondrial fission complexes by Fis1. Structural basis for recruitment of mitochondrial fission complexes by Fis1. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Zhang Y., Chan DC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhang Y., Chan DC. DIP original experiment: DIP-111319X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structural basis for recruitment of mitochondrial fission complexes by Fis1. Structural basis for recruitment of mitochondrial fission complexes by Fis1. Structural basis for recruitment of mitochondrial fission complexes by Fis1. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Zhang Y., Chan DC. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Zhang Y., Chan DC. DIP original experiment: DIP-111313X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structural basis for recruitment of mitochondrial fission complexes by Fis1. Structural basis for recruitment of mitochondrial fission complexes by Fis1. Structural basis for recruitment of mitochondrial fission complexes by Fis1. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Zhang Y., Chan DC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zhang Y., Chan DC. DIP original experiment: DIP-111317X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structural basis for recruitment of mitochondrial fission complexes by Fis1. Structural basis for recruitment of mitochondrial fission complexes by Fis1. Structural basis for recruitment of mitochondrial fission complexes by Fis1. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Zhang Y., Chan DC. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Zhang Y., Chan DC. DIP original experiment: DIP-111318X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structural basis for recruitment of mitochondrial fission complexes by Fis1. Structural basis for recruitment of mitochondrial fission complexes by Fis1. Structural basis for recruitment of mitochondrial fission complexes by Fis1. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Zhang Y., Chan DC. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Zhang Y., Chan DC. DIP original experiment: DIP-111314X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structural basis for recruitment of mitochondrial fission complexes by Fis1. Structural basis for recruitment of mitochondrial fission complexes by Fis1. Structural basis for recruitment of mitochondrial fission complexes by Fis1. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Zhang Y., Chan DC. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Zhang Y., Chan DC. DIP original experiment: DIP-111312X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structural basis for recruitment of mitochondrial fission complexes by Fis1. Structural basis for recruitment of mitochondrial fission complexes by Fis1. Structural basis for recruitment of mitochondrial fission complexes by Fis1. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Zhang Y., Chan DC. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Zhang Y., Chan DC. DIP original experiment: DIP-111315X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structural basis for recruitment of mitochondrial fission complexes by Fis1. mdv1_yeast Mitochondrial division protein 1 YJL112W J0802 MDV1 FIS2 GAG3 NET2 Mitochondria fission 2 protein protein protein yeast Saccharomyces cerevisiae Baker's yeast MSVNDQITHIGKTLSTTASAFLNYQKSNSNTQDVLTNNGPYKNLLSNTVNNASSTSYFYKRTEHGRFVKNASNTFEDIYSKTRRGDVFRNKFTDNKTCFRMLTYISDDLLNEIPTKEGLKSDADGKLLTEGGENENLRKNASKKETSLFQGFKSYLPIAELAIENTERLNYDTNGTSGTVGAKDVMSKTNERDEIHTELPNFQDSFLIPPGVETKKISSSYSPSALKSFSQTLVNSLEFLNIQKNSTLSEIRDIEVEVENLRQKKEKLLGKIANIEQNQLLLEDNLKQIDDRLDFLEEYGLEVIEANSDENAEDDGMSERKALKNDAIRNEGVTTESISSEASNLPPRRRQQLRDDNSLNRLGAFYSKSKKRHRKSFPTFQQLYEPGTKIGSIMSTHDDFLTCLDFDAPFGTLCTAGYLDHTVKIWDLSKQNKIGELAGHLATINCMQINRDYGTLVTGGRDAALKLWNLNLAQQLYQETQNLTSPTNHIDSPCVHTFEAHTDEVTALSLDPSFLVSGSQDRTIRQWDLRSGKCLQTIDLSFANVLTTSTNVDLSKSTLLTQRNERPSIGALQSFDAALATGTKDGVVRLWDLRSGKVIRTLKGHTDAITSLKFDSACLVTGSYDRTVRIWDLRTGLLNKFHAYSAPVLSLDLFQENAAVVVADEPSVQIYDSEKDESWSCVEQGNETSVSTVKYKENYMVEGRENGDVNIWAV CA8A23DBB06193A6 CA8A23DBB06193A6 fis1_yeast Mitochondrial fission 1 protein Mitochondrial division protein 2 FIS1 MDV2 YIL065C protein protein yeast Saccharomyces cerevisiae Baker's yeast MTKVDFWPTLKDAYEPLYPQQLEILRQQVVSEGGPTATIQSRFNYAWGLIKSTDVNDERLGVKILTDIYKEAESRRRECLYYLTIGCYKLGEYSMAKRYVDTLFEHERNNKQVGALKSMVEDKIQKETLKGVVVAGGVLAGAVAVASFFLRNKRR BD62D19524770536 BD62D19524770536 caf4_yeast CCR4-associated factor 4 YKR036C CAF4 protein protein yeast Saccharomyces cerevisiae Baker's yeast MGSGDTRGESSLVAKPIEIILNKLPHAILAQQQFQKYITSPIYRYLSKLLLFREVAWPESTKDTQKGQVGIFSFQNNYADSATTFRILAHLDEQRYPLPNGAAEKNLPSLFEGFKATVSIIQQRLLLDNVDGATNSDKEKYVQLPDINTGFVNKTYSRIDLTHLLEDVETNVENLSINKTLEMDELTRLDSMINELESRKLKILERVKHIDSKSTNLENDVTLIKDRINFIEEYNLEADREQSLRKQMEEERSSEASSFTQNEEAISSLCDVESKDTRLKDFYKMPHEKSHDKNRQIISETYSRNTTAFRMTIPHGEHGNSITALDFDTPWGTLCSSSYQDRIVKVWDLNHGIQVGELPGHLATVNCMQIDKKNYNMLITGSKDATLKLWDLNLSREIYLDHSPLKEKTEEIVTPCIHNFELHKDEITALSFDSEALVSGSRDKKIFHWDLTTGKCIQQLDLIFTPTHSDIKMPARSLNNGACLLGTEAPMIGALQCYNSALATGTKDGIVRLWDLRVGKPVRLLEGHTDGITSLKFDSEKLVTGSMDNSVRIWDLRTSSILDVIAYDLPVSSLDFDGKLITVGANEGGVNVFNMERDEHWMTPEPPHSLDGDELSRRIAIVKYKDGFLINGHNDGDINVWTL 2C6B472CCC2340D3 2C6B472CCC2340D3 caf4-fis1-1 6 11 unspecified role unspecified role unspecified role unspecified role Region 81-140 Region 81-140 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 10 unspecified role unspecified role unspecified role unspecified role Region 1-129 Region 1-129 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction fis1-mdv1-1 7 10 unspecified role unspecified role unspecified role unspecified role Region 1-129 Region 1-129 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role Region 122-171 Region 122-171 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction fis1-mdv1-2 5 10 unspecified role unspecified role bait bait P40515:p.[Phe43Ala;Asn44Ala] F43A/N44A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain N A certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F43A/N44A'. Wed May 02 14:54:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe43ala,asn44ala' Tue Jun 30 17:43:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe43Ala;Asn44Ala]' P40515:p.Trp47Ala W47A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain W A This feature has been corrected as a result of our quality control procedures. The original label was 'W47A'. Wed May 02 15:47:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp47ala' Tue Jun 30 17:36:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp47Ala' P40515:p.[Ile24Ala;Leu25Ala] I24A/L25A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain I A This feature has been corrected as a result of our quality control procedures. The original label was 'I24A/L25A'. Wed May 02 18:30:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile24ala,leu25ala' Tue Jun 30 17:45:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ile24Ala;Leu25Ala]' Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 9 unspecified role unspecified role prey prey P47025:p.Leu148Ala L148A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L148A'. Wed May 02 19:07:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu148ala' Tue Jun 30 19:29:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu148Ala' P47025:p.Phe149Ala F149A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F149A'. Wed May 02 19:20:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe149ala' Tue Jun 30 18:21:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe149Ala' P47025:p.Phe152Ala F152A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F152A'. Wed May 02 17:10:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe152ala' Tue Jun 30 16:39:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe152Ala' P47025:p.[Phe99Ala;Arg100Ala] F99A/R100A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F A certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'F99A/R100A'. Wed May 02 19:58:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe99ala,arg100ala' Tue Jun 30 20:12:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe99Ala;Arg100Ala]' P47025:p.Ile105Ala I105A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain I A This feature has been corrected as a result of our quality control procedures. The original label was 'I105A'. Wed May 02 14:26:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile105ala' Tue Jun 30 18:05:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile105Ala' HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association mdv1-fis1-1 1 10 unspecified role unspecified role prey prey Region 1-127 Region 1-127 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 9 unspecified role unspecified role bait bait Binding region 88-164 Binding region 88-164 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction fis1-caf4-1 2 11 unspecified role unspecified role prey prey P36130:p.Leu110Ala L126A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L A Wed May 02 15:00:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu110ala' Tue Jun 30 18:01:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu110Ala' P36130:p.Phe111Ala F127A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F A Wed May 02 15:21:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe111ala' Tue Jun 30 16:55:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe111Ala' P36130:p.Phe114Ala F130A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F A Wed May 02 16:13:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe114ala' Tue Jun 30 18:04:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe114Ala' P36130:p.Phe85_Arg86delinsAlaAla F101A/R102A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain FR AA Wed May 02 16:42:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe_arg85-86ala_ala' Tue Jun 30 17:20:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe85_Arg86delinsAlaAla' P36130:p.Leu88Ala L107A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L A Wed May 02 16:42:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu88ala' Tue Jun 30 17:08:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu88Ala' HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 10 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association caf4-fis1-2 8 11 unspecified role unspecified role unspecified role unspecified role Region 81-140 Region 81-140 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 10 unspecified role unspecified role unspecified role unspecified role Region 1-129 Region 1-129 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction fis1-mdv1-3 3 10 unspecified role unspecified role unspecified role unspecified role Region 1-129 Region 1-129 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role Region 122-171 Region 122-171 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction caf4-fis1-3 4 11 unspecified role unspecified role bait bait Binding region 90-142 Binding region 90-142 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 10 unspecified role unspecified role prey prey Region 1-127 Region 1-127 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction