DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Drosophila TRP channels require a protein with a distinctive motif encoded by the inaF locus. Drosophila TRP channels require a protein with a distinctive motif encoded by the inaF locus. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Cheng Y., Nash HA. Only protein-protein interactions drome Drosophila melanogaster (Fruit fly) Fruit fly anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Cheng Y., Nash HA. DIP original experiment: DIP-111358X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Drosophila TRP channels require a protein with a distinctive motif encoded by the inaF locus. Drosophila TRP channels require a protein with a distinctive motif encoded by the inaF locus. Drosophila TRP channels require a protein with a distinctive motif encoded by the inaF locus. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Cheng Y., Nash HA. Only protein-protein interactions drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Cheng Y., Nash HA. DIP original experiment: DIP-111357X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Drosophila TRP channels require a protein with a distinctive motif encoded by the inaF locus. Drosophila TRP channels require a protein with a distinctive motif encoded by the inaF locus. Drosophila TRP channels require a protein with a distinctive motif encoded by the inaF locus. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Cheng Y., Nash HA. Only protein-protein interactions drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Cheng Y., Nash HA. DIP original experiment: DIP-111360X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Drosophila TRP channels require a protein with a distinctive motif encoded by the inaF locus. Drosophila TRP channels require a protein with a distinctive motif encoded by the inaF locus. Drosophila TRP channels require a protein with a distinctive motif encoded by the inaF locus. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Cheng Y., Nash HA. Only protein-protein interactions drome Drosophila melanogaster (Fruit fly) Fruit fly anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Cheng Y., Nash HA. DIP original experiment: DIP-111359X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Drosophila TRP channels require a protein with a distinctive motif encoded by the inaF locus. q9vud5_drome nan TRPV Dmel_CG5842 DmNan Dmel\CG5842 NAN Nan OCR CT18317 CG5842 Iav protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MGNTESNVTSGVKKQAGVSTQALYKFVNLKGGGLLVDMMKRACQTKQFAEIDHAIKTKVEPFLYNKGAGRYFPISKLVLLRNRDRPRTRQLPEIRALENPDDDFNIHDYCPEVSEAEYISNPTAYRFVCWDLNMRGAVGETILHLCLLNASSLHADLAKRLLKFYPKLILDIYMSDEYYGESVLHIAIVNEDPAMVKYLLDANADVQERCCGAFMSAEDTKFSRTDSPDHEYVALCPMTNYDGYVYWGEYPLSFAACLSQEECFRLVLARGADPDFQDTNGNTVLHMLVIYEKIEMFDVGYEVGTNIHIKNIQNLTPLTLAAKLGRVEMFFHVMSIEREIYWQLGSITCAAYPLLMIDTINEETGNINKDSVLNFVVFGDKLEHLELLDGVVIDLLKTKWDTFCKSRFYKQFYMFALYFLISLFSFILRPGPDAKDEDEDGANSTTAKSDLYRQNGSDSYHLHSKRATMTTEYKTFWLNFTEYYDPSEVEVLPAWWESYAQCPLMNLESDLAKLRIMAELLNFVGAILYLLVALREARFLGLKMFIENLMTAPSRVMFLFSCALMMTIPWLRVSCLTEIDDHVTVVIMLTTAPYFLFFCRGFKTVGPFVVMIYRMVMGDLLRFVSIYLVFVMGFSQAFYIIFLTFDNPSSPEDQDAESNPMPSPMESIVAMFLMSLTNFGDYYGAMVSTQHEYEAKILFFLFMVIVSVLLVNMLIAMMGNTYQKIAEIRNEWQRQWARIVLVVERSVPPAERLKNFMQYSQSMSDGRRALVLRLNMTEEKEEMKEVQEMKRIHQRFAKKRQMEREARALRRQQEYEKFFGTAPKSECSDNNNF DIP protein Q9VUD5 original sequence version: 61 DCE6BEC9D66ABB40 a8wh76_drome INAF INAF-B InaF inaF Dmel_CG42447 inaF-B CG42447-RA CG42447 Dmel\CG42447 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSGPSALMANLADVVKEAKDEEIPMPKSNDFFESKTFRLLTLLLYMGGVSGMGLTLAVYYLFIWDSRMPPLPVFKHTHPIG inad_drome Inactivation-no-after-potential D protein inaD CG3504 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MVQFLGKQGTAGELIHMVTLDKTGKKSFGICIVRGEVKDSPNTKTTGIFIKGIVPDSPAHLCGRLKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELEIQTFDKSDEQQAKSDPRSNGYMQAKNKFNQEQTTNNNASGGQGMGQGQGQGQGMAGMNRQQSMQKRNTTFTASMRQKHSNYADEDDEDTRDMTGRIRTEAGYEIDRASAGNCKLNKQEKDRDKEQEDEFGYTMAKINKRYNMMKDLRRIEVQRDASKPLGLALAGHKDRQKMACFVAGVDPNGALGSVDIKPGDEIVEVNGNVLKNRCHLNASAVFKNVDGDKLVMITSRRKPNDEGMCVKPIKKFPTASDETKFIFDQFPKARTVQVRKEGFLGIMVIYGKHAEVGSGIFISDLREGSNAELAGVKVGDMLLAVNQDVTLESNYDDATGLLKRAEGVVTMILLTLKSEEAIKAEKAAEEKKKEEAKKEEEKPQEPATAEIKPNKKILIELKVEKKPMGVIVCGGKNNHVTTGCVITHVYPEGQVAADKRLKIFDHICDINGTPIHVGSMTTLKVHQLFHTTYEKAVTLTVFRADPPELEKFNVDLMKKAGKELGLSLSPNEIGCTIADLIQGQYPEIDSKLQRGDIITKFNGDALEGLPFQVCYALFKGANGKVSMEVTRPKPTLRTEAPKA DIP protein Q24008 original sequence version: 68 DIP protein Q24008 original sequence version: 131 D4C24091D99EA7F3 inafb-nan-1 2 5 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly 6 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association inafb-inad-1 3 6 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range drome Drosophila melanogaster (Fruit fly) Fruit fly 7 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association inad-inafb-1 1 6 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range drome Drosophila melanogaster (Fruit fly) Fruit fly 7 unspecified role unspecified role bait bait drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association nan-inafb-1 4 5 unspecified role unspecified role bait bait drome Drosophila melanogaster (Fruit fly) Fruit fly 6 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association