DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu An essential role for cortactin in the modulation of the potassium channel Kv1.2. An essential role for cortactin in the modulation of the potassium channel Kv1.2. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Williams MR., Markey JC., Doczi MA., Morielli AD. Only protein-protein interactions human Homo sapiens Human fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Williams MR., Markey JC., Doczi MA., Morielli AD. DIP original experiment: DIP-111375X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx An essential role for cortactin in the modulation of the potassium channel Kv1.2. An essential role for cortactin in the modulation of the potassium channel Kv1.2. An essential role for cortactin in the modulation of the potassium channel Kv1.2. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Williams MR., Markey JC., Doczi MA., Morielli AD. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Williams MR., Markey JC., Doczi MA., Morielli AD. DIP original experiment: DIP-111376X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx An essential role for cortactin in the modulation of the potassium channel Kv1.2. An essential role for cortactin in the modulation of the potassium channel Kv1.2. An essential role for cortactin in the modulation of the potassium channel Kv1.2. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Williams MR., Markey JC., Doczi MA., Morielli AD. Only protein-protein interactions human Homo sapiens Human pull down pull down predetermined predetermined participant predetermined Williams MR., Markey JC., Doczi MA., Morielli AD. DIP original experiment: DIP-111377X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx An essential role for cortactin in the modulation of the potassium channel Kv1.2. src8_mouse Src substrate cortactin Cttn Ems1 protein protein mouse Mus musculus Mouse MWKASAGHAVSITQDDGGADDWETDPDFVNDVSEKEQRWGAKTVQGSGHQEHINIHKLRENVFQEHQTLKEKELETGPKASHGYGGKFGVEQDRMDRSAVGHEYQSKLSKHCSQVDSVRGFGGKFGVQMDRVDQSAVGFEYQGKTEKHASQKDYSSGFGGKYGVQADRVDKSAVGFDYQGKTEKHESQKDYSKGFGGKYGIDKDKVDKSAVGFEYQGKTEKHESQKDYVKGFGGKFGVQTDRQDKCALGWDHQEKLQLHESQKDYKTGFGGKFGVQSERQDSSAVGFDYKERLAKHESQQDYAKGFGGKYGVQKDRMDKNASTFEEVVQVPSAYQKTVPIEAVTSKTSNIRANFENLAKEREQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKKQTPPASPSPQPIEDRPPSSPIYEDAAPFKAEPSYRGSEPEPEYSIEAAGIPEAGSQQGLTYTSEPVYETTEAPGHYQAEDDTYDGYESDLGITAIALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANYVELRQ DIP protein Q60598 original sequence version: 136 DIP protein Q60598 original sequence version: 78 DIP protein Q60598 original sequence version: 135 8F5CA026ACCD6D4F kcna2_mouse Potassium voltage-gated channel subfamily A member 2 Voltage-gated potassium channel subunit Kv1.2 Kcna2 MK2 protein protein mouse Mus musculus Mouse MTVATGDPVDEAAALPGHPQDTYDPEADHECCERVVINISGLRFETQLKTLAQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGEEAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSFCLETLPIFRDENEDMHGGGVTFHTYSNSTIGYQQSTSFTDPFFIVETLCIIWFSFEFLVRFFACPSKAGFFTNIMNIIDIVAIIPYFITLGTELAEKPEDAQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERDSQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQYLQVTSCPKIPSSPDLKKSRSASTISKSDYMEIQEGVNNSNEDFREENLKTANCTLANTNYVNITKMLTDV DIP protein P63141 original sequence version: 55 A8FEA6F3F59AF42A cttn-kcna2-1 1 5 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 4 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human proximity proximity close-contact colocalization neighbourhood interaction kcna2-cttn-1 2 5 unspecified role unspecified role bait bait GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range 413-499 binding site 413-499 binding site required to bind necessary binding region required to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 4 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association kcna2-cttn-2 3 5 unspecified role unspecified role bait bait GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 4 unspecified role unspecified role prey prey flag tag flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range 1-330 1-330 sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human physical association physical association