DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu ephrinB1 signals from the cell surface to the nucleus by recruitment of STAT3. ephrinB1 signals from the cell surface to the nucleus by recruitment of STAT3. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Bong YS., Lee HS., Carim-Todd L., Mood K., Nishanian TG., Tessarollo L., Daar IO. Only protein-protein interactions xenla Xenopus laevis (African clawed frog) African clawed frog anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Bong YS., Lee HS., Carim-Todd L., Mood K., Nishanian TG., Tessarollo L., Daar IO. DIP original experiment: DIP-261853X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx ephrinB1 signals from the cell surface to the nucleus by recruitment of STAT3. ephrinB1 signals from the cell surface to the nucleus by recruitment of STAT3. ephrinB1 signals from the cell surface to the nucleus by recruitment of STAT3. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Bong YS., Lee HS., Carim-Todd L., Mood K., Nishanian TG., Tessarollo L., Daar IO. Only protein-protein interactions xenla Xenopus laevis (African clawed frog) African clawed frog anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Bong YS., Lee HS., Carim-Todd L., Mood K., Nishanian TG., Tessarollo L., Daar IO. DIP original experiment: DIP-261848X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx ephrinB1 signals from the cell surface to the nucleus by recruitment of STAT3. ephrinB1 signals from the cell surface to the nucleus by recruitment of STAT3. ephrinB1 signals from the cell surface to the nucleus by recruitment of STAT3. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Bong YS., Lee HS., Carim-Todd L., Mood K., Nishanian TG., Tessarollo L., Daar IO. Only protein-protein interactions xenla Xenopus laevis (African clawed frog) African clawed frog anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Bong YS., Lee HS., Carim-Todd L., Mood K., Nishanian TG., Tessarollo L., Daar IO. DIP original experiment: DIP-261842X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx ephrinB1 signals from the cell surface to the nucleus by recruitment of STAT3. ephrinB1 signals from the cell surface to the nucleus by recruitment of STAT3. ephrinB1 signals from the cell surface to the nucleus by recruitment of STAT3. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Bong YS., Lee HS., Carim-Todd L., Mood K., Nishanian TG., Tessarollo L., Daar IO. Only protein-protein interactions xenla Xenopus laevis (African clawed frog) African clawed frog anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Bong YS., Lee HS., Carim-Todd L., Mood K., Nishanian TG., Tessarollo L., Daar IO. DIP original experiment: DIP-261849X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx ephrinB1 signals from the cell surface to the nucleus by recruitment of STAT3. ephrinB1 signals from the cell surface to the nucleus by recruitment of STAT3. ephrinB1 signals from the cell surface to the nucleus by recruitment of STAT3. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Bong YS., Lee HS., Carim-Todd L., Mood K., Nishanian TG., Tessarollo L., Daar IO. Only protein-protein interactions xenla Xenopus laevis (African clawed frog) African clawed frog anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Bong YS., Lee HS., Carim-Todd L., Mood K., Nishanian TG., Tessarollo L., Daar IO. DIP original experiment: DIP-261852X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx ephrinB1 signals from the cell surface to the nucleus by recruitment of STAT3. ephrinB1 signals from the cell surface to the nucleus by recruitment of STAT3. ephrinB1 signals from the cell surface to the nucleus by recruitment of STAT3. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Bong YS., Lee HS., Carim-Todd L., Mood K., Nishanian TG., Tessarollo L., Daar IO. Only protein-protein interactions xenla Xenopus laevis (African clawed frog) African clawed frog anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Bong YS., Lee HS., Carim-Todd L., Mood K., Nishanian TG., Tessarollo L., Daar IO. DIP original experiment: DIP-261839X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx ephrinB1 signals from the cell surface to the nucleus by recruitment of STAT3. ephrinB1 signals from the cell surface to the nucleus by recruitment of STAT3. ephrinB1 signals from the cell surface to the nucleus by recruitment of STAT3. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Bong YS., Lee HS., Carim-Todd L., Mood K., Nishanian TG., Tessarollo L., Daar IO. Only protein-protein interactions xenla Xenopus laevis (African clawed frog) African clawed frog anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Bong YS., Lee HS., Carim-Todd L., Mood K., Nishanian TG., Tessarollo L., Daar IO. DIP original experiment: DIP-261841X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx ephrinB1 signals from the cell surface to the nucleus by recruitment of STAT3. ephrinB1 signals from the cell surface to the nucleus by recruitment of STAT3. ephrinB1 signals from the cell surface to the nucleus by recruitment of STAT3. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Bong YS., Lee HS., Carim-Todd L., Mood K., Nishanian TG., Tessarollo L., Daar IO. Only protein-protein interactions xenla Xenopus laevis (African clawed frog) African clawed frog anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Bong YS., Lee HS., Carim-Todd L., Mood K., Nishanian TG., Tessarollo L., Daar IO. DIP original experiment: DIP-261847X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx ephrinB1 signals from the cell surface to the nucleus by recruitment of STAT3. ephrinB1 signals from the cell surface to the nucleus by recruitment of STAT3. ephrinB1 signals from the cell surface to the nucleus by recruitment of STAT3. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Bong YS., Lee HS., Carim-Todd L., Mood K., Nishanian TG., Tessarollo L., Daar IO. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Bong YS., Lee HS., Carim-Todd L., Mood K., Nishanian TG., Tessarollo L., Daar IO. DIP original experiment: DIP-261840X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx ephrinB1 signals from the cell surface to the nucleus by recruitment of STAT3. ephrinB1 signals from the cell surface to the nucleus by recruitment of STAT3. ephrinB1 signals from the cell surface to the nucleus by recruitment of STAT3. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Bong YS., Lee HS., Carim-Todd L., Mood K., Nishanian TG., Tessarollo L., Daar IO. Only protein-protein interactions xenla Xenopus laevis (African clawed frog) African clawed frog anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Bong YS., Lee HS., Carim-Todd L., Mood K., Nishanian TG., Tessarollo L., Daar IO. DIP original experiment: DIP-261845X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx ephrinB1 signals from the cell surface to the nucleus by recruitment of STAT3. ephrinB1 signals from the cell surface to the nucleus by recruitment of STAT3. ephrinB1 signals from the cell surface to the nucleus by recruitment of STAT3. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Bong YS., Lee HS., Carim-Todd L., Mood K., Nishanian TG., Tessarollo L., Daar IO. Only protein-protein interactions xenla Xenopus laevis (African clawed frog) African clawed frog anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Bong YS., Lee HS., Carim-Todd L., Mood K., Nishanian TG., Tessarollo L., Daar IO. DIP original experiment: DIP-261850X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx ephrinB1 signals from the cell surface to the nucleus by recruitment of STAT3. ephrinB1 signals from the cell surface to the nucleus by recruitment of STAT3. ephrinB1 signals from the cell surface to the nucleus by recruitment of STAT3. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Bong YS., Lee HS., Carim-Todd L., Mood K., Nishanian TG., Tessarollo L., Daar IO. Only protein-protein interactions xenla Xenopus laevis (African clawed frog) African clawed frog anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Bong YS., Lee HS., Carim-Todd L., Mood K., Nishanian TG., Tessarollo L., Daar IO. DIP original experiment: DIP-261844X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx ephrinB1 signals from the cell surface to the nucleus by recruitment of STAT3. ephrinB1 signals from the cell surface to the nucleus by recruitment of STAT3. ephrinB1 signals from the cell surface to the nucleus by recruitment of STAT3. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Bong YS., Lee HS., Carim-Todd L., Mood K., Nishanian TG., Tessarollo L., Daar IO. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Bong YS., Lee HS., Carim-Todd L., Mood K., Nishanian TG., Tessarollo L., Daar IO. DIP original experiment: DIP-261843X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx ephrinB1 signals from the cell surface to the nucleus by recruitment of STAT3. ephrinB1 signals from the cell surface to the nucleus by recruitment of STAT3. ephrinB1 signals from the cell surface to the nucleus by recruitment of STAT3. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Bong YS., Lee HS., Carim-Todd L., Mood K., Nishanian TG., Tessarollo L., Daar IO. Only protein-protein interactions xenla Xenopus laevis (African clawed frog) African clawed frog anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Bong YS., Lee HS., Carim-Todd L., Mood K., Nishanian TG., Tessarollo L., Daar IO. DIP original experiment: DIP-261851X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx ephrinB1 signals from the cell surface to the nucleus by recruitment of STAT3. ephrinB1 signals from the cell surface to the nucleus by recruitment of STAT3. ephrinB1 signals from the cell surface to the nucleus by recruitment of STAT3. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Bong YS., Lee HS., Carim-Todd L., Mood K., Nishanian TG., Tessarollo L., Daar IO. Only protein-protein interactions xenla Xenopus laevis (African clawed frog) African clawed frog anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Bong YS., Lee HS., Carim-Todd L., Mood K., Nishanian TG., Tessarollo L., Daar IO. DIP original experiment: DIP-261846X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx ephrinB1 signals from the cell surface to the nucleus by recruitment of STAT3. q6pf53_xenla efnb2.L efnb2 efnb2a XELAEV_18013082mg protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MALSGDSVWKYSLGVCILLLRTAISWSTVLDPIYWNSSNARFLPGQGLILYPKIGDKLDIICPKVDSKSTGQYEYYKIYLVDKEQADSCTIKDRTPLLNCAKPDQDVKFTIKFQEFSPNLWGLEFQRDKDYYIISTSNGSIEGVDNQEGGVCVTKAMKILMKVGQDPDFHNHRGSSSTRRPDHESGTNGKSSTTSPHVNGPEGSSTDGKNAGHSSILGSEVALFAGIASGCIIFIVIIITLVVLLLKYRRRHRKHSPQHTTTLSLSTLATPKRSGNNNGSEPSDIIIPLRTAEGVFCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV DIP protein Q6PF53 original sequence version: 53 q9pt69_xenla efnb3.L efnb3 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MFSRECALYIRMLFTLWDFCSISALSLDPIYWNSSNKRFEDTEGYVLYPQIGDRLDLLCPRSEPQGPFSSSPYEYYKLYLVGTKEEMSSCSILRTPNLLLTCDRPSQDLRFTIKFQEFSPNLWGHEFQSQRDYYIIATSDGTMDGIETLQGGVCETKGMKVTLKVGQSPNGATPPRRPSSAGKDSGISPSVPNPDIPNVGETSGNATKTGENGPLPISHVPLVAGAAGGAALLLLVFGVVGWVCHRRRQAKHSDTRHPPLSLGSITSPKRGGNNNGHEPSDIIMPLRPSEAGAFCPHYEKVSGDYGHPVYIVQDMASQSPANIYYKV DIP protein Q9PT69 original sequence version: 68 jak2_mouse Tyrosine-protein kinase JAK2 Janus kinase 2 Jak2 protein protein mouse Mus musculus Mouse MGMACLTMTEMEATSTSPVHQNGDIPGSANSVKQIEPVLQVYLYHSLGQAEGEYLKFPSGEYVAEEICVAASKACGITPVYHNMFALMSETERIWYPPNHVFHIDESTRHDILYRIRFYFPHWYCSGSSRTYRYGVSRGAEAPLLDDFVMSYLFAQWRHDFVHGWIKVPVTHETQEECLGMAVLDMMRIAKEKDQTPLAVYNSVSYKTFLPKCVRAKIQDYHILTRKRIRYRFRRFIQQFSQCKATARNLKLKYLINLETLQSAFYTEQFEVKESARGPSGEEIFATIIITGNGGIQWSRGKHKESETLTEQDVQLYCDFPDIIDVSIKQANQECSNESRIVTVHKQDGKVLEIELSSLKEALSFVSLIDGYYRLTADAHHYLCKEVAPPAVLENIHSNCHGPISMDFAISKLKKAGNQTGLYVLRCSPKDFNKYFLTFAVERENVIEYKHCLITKNENGEYNLSGTKRNFSNLKDLLNCYQMETVRSDSIIFQFTKCCPPKPKDKSNLLVFRTNGISDVQISPTLQRHNNVNQMVFHKIRNEDLIFNESLGQGTFTKIFKGVRREVGDYGQLHKTEVLLKVLDKAHRNYSESFFEAASMMSQLSHKHLVLNYGVCVCGEENILVQEFVKFGSLDTYLKKNKNSINILWKLGVAKQLAWAMHFLEEKSLIHGNVCAKNILLIREEDRRTGNPPFIKLSDPGISITVLPKDILQERIPWVPPECIENPKNLNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDKHQLPAPKWTELANLINNCMDYEPDFRPAFRAVIRDLNSLFTPDYELLTENDMLPNMRIGALGFSGAFEDRDPTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSAGRRNLRLIMEYLPYGSLRDYLQKHKERIDHKKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPVEFMRMIGNDKQGQMIVFHLIELLKSNGRLPRPEGCPDEIYVIMTECWNNNVSQRPSFRDLSLRVDQIRDSIAA DIP protein Q62120 original sequence version: 149 DIP protein Q62120 original sequence version: 109 DIP protein Q62120 original sequence version: 117 DIP protein Q62120 original sequence version: 110 7BA35989B880D0A6 stat3_mouse Signal transducer and activator of transcription 3 Acute-phase response factor Stat3 Aprf protein protein mouse Mus musculus Mouse MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEELADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQHRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNYQLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGNGGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWYNMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYSGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILSTKPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIMDATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMDLTSECATSPM DIP protein P42227 original sequence version: 169 DIP protein P42227 original sequence version: 162 DIP protein P42227 original sequence version: 164 DIP protein P42227 original sequence version: 141 6C00626711C8012D f1m9d6_rat Signal transducer and activator of transcription rCG_22495 Stat1 protein protein rat Rattus norvegicus (Rat) Rat MSQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAAYDVSFATIRFHDLLSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPVQMSMIIHNCLKEERKILENAQRFNQAQEGNIQNTVMLDKQKELDSKVRNVKDQVMCIEHEIKTLEDLQDEYDFKCKTSQNRESEANGVAKSDQKQEQLLLHKMFLMLDNKRKEIIHKIRELLNSIELTQNTLINDELVEWKRRQQSACIGGPPNACLDQLQSWFTIVAESLQQVRQQLKKLEELEQKFTYEQDPITKNKQVLSDRTFVLFQQLIQSSFVVERQPCMPTHPQRPLVLKTGVQFTVKLRLLVKLQELNYNLKVKVSFDKDVNEKNTVKGFRKFNILGTHTKVMNMEESTNGSLAAEFRHLQLKEQKNAGNRTNEGPLIVTEELHSLSFETQLCQPGLVIDLETTSLPVVVISNVSQLPSGWASILWYNMLVTEPRNLSFFLNPPCAWWSQLSEVLSWQFSSVTKRGLNADQLSMLGEKLLGPNAGPDGLIPWTRFCKENINDKNFSFWPWIDTILELIKKHLLCLWNDGCIMGFISKERERALLKDQQPGTFLLRFSESSREGAITFTWVERSQNGGEPDFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIPENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDDPKRTGYIKTELISVSEVHPSRLQSTENLLPMSPEEFDEMSKIVGSEFDSMMSAV DIP protein F1M9D6 original sequence version: 26 efnb1_xenla Ephrin-B1 efnb1 eplg2 lerk2 ELK ligand EPH-related receptor tyrosine kinase ligand 2 XlERK protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MEGLRRLLGLLLVLYRLCSALGKNLEPVTWNSQNPRFISGKGLVLYPEIGDRLDIICPKGDSSQPYEYYKLYMVRRDQLEACSTVIDPNVLVTCNQPGKEYRFTIKFQEFSPNYMGLEFRRNQDYYITSTSNSTLQGLENREGGVCQTRSMKIIMKVGQDPNAVPPEQLTTTRPSKEADNTGKIATFGPWNGPVENPGKSDTNLSDKPTAGGGVDGFFNSKIAVFAAIGAGCVIFILIIIFLVVLLIKIRKRHRKHTQQRAAALSLSTLASPKCSGNAGSEPSDIIIPLRTTENNYCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV DIP protein O13097 original sequence version: 83 stat3_rat Signal transducer and activator of transcription 3 Stat3 protein protein rat Rattus norvegicus (Rat) Rat MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEELADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQHRPMLEERIVDLFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNYQLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGNGGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWYNMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYSGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILSTKPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIMDATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMDLTSECATSPM DIP protein P52631 original sequence version: 127 D74A0C76954754ED lmo4a_xenla LIM domain transcription factor LMO4-A lmo4-a lmo4 LIM domain only protein 4-A Xlmo4 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MVNNRSSESTTTAVSSNGSPPKACAGCGGKIGDRFLLYSMDRYWHTRCLKCSCCQAQLGEIGTSCYTKSGMILCRNDYIRLFGNSGACNACGQSIPASEMVMRAQGSVYHLKCFTCATCRNRLVPGDRFHYVNGTIFCEHDRPTGLLNGHLNPLQSNPLQGSPMLPDQKVC DIP protein Q8AW92 original sequence version: 55 efnb1_mouse Ephrin-B1 Efnb1 Epl2 Eplg2 Lerk2 Stra1 EPH-related receptor tyrosine kinase ligand 2 CEK5 receptor ligand Stimulated by retinoic acid gene 1 protein ELK ligand EFL-3 protein protein mouse Mus musculus Mouse MARPGQRWLSKWLVAMVVLTLCRLATPLAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNKPHQEIRFTIKFQEFSPNYMGLEFKKYHDYYITSTSNGSLEGLENREGGVCRTRTMKIVMKVGQDPNAVTPEQLTTSRPSKESDNTVKTATQAPGRGSQGDSDGKHETVNQEEKSGPGAGGGGSGDSDSFFNSKVALFAAVGAGCVIFLLIIIFLTVLLLKLRKRHRKHTQQRAAALSLSTLASPKGGSGTAGTEPSDIIIPLRTTENNYCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV DIP protein P52795 original sequence version: 55 DIP protein P52795 original sequence version: 120 Binds to the receptor tyrosine kinases EPHB1 and EPHA1. Binds to, and induce the collapse of, commissural axons/growth cones in vitro. May play a role in constraining the orientation of longitudinally projecting axons mint 8C96FD3DC5CBC405 sta5b_rat Signal transducer and activator of transcription 5B Stat5b protein protein rat Rattus norvegicus (Rat) Rat MAMWIQAQQLQGDALHQMQALYGQHFPIEVRHYLSQWIESQAWDSIDLDNPQENIKATQLLEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLVREANNGSSPAGSLADAMSQKHLQINQTFEELRLITQDTESELKKLQQTQEYFIIQYQESLRIQAQFAQLAQLNPQERMSRETALQQKQVSLETWLQREAQTLQQYRVELAEKHQKTLQLLRKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRLEHLCQQLPIPGPVEEMLAEVNATITDIISALSTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKLNVHMNPPQVKATIISEQQAKSLLKNENTRNDYSGEILNNCCVMEYHQATGTLSAHFRNMSLKRIKRSDRRGAESVTEEKFTILFDSQFSVGGNELVFQVKTLSLPVVVIVHGSQDNNATATVLWDNAFREPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNSSSNHLEDYNSMSVSWSQFNRENLPGRNYTFWQWFDGVMEVLKKHLKPHWNDGAILGFVNKQQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSQERMFWNLMPFTTRDFSIRSLADRLGDLNYLIYVFPDRPKDEVYSKYYTPVPCERATAKAADGYVKPQIKQVVPEFVNASTDAGSGATYMDQAPSPVVCPQAHYNMYPQNPDSVLDTDGDFDLEDTMDVARRVEELLGRPMDSQWIPHAQS DIP protein P52632 original sequence version: 116 efnb1-lmo4_a-1 6 23 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range xenla Xenopus laevis (African clawed frog) African clawed frog 21 unspecified role unspecified role bait bait xenla Xenopus laevis (African clawed frog) African clawed frog physical association physical association efnb1-stat3-1 12 22 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range xenla Xenopus laevis (African clawed frog) African clawed frog 21 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range xenla Xenopus laevis (African clawed frog) African clawed frog physical association physical association efnb1-stat3-2 1 22 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range xenla Xenopus laevis (African clawed frog) African clawed frog 21 unspecified role unspecified role bait bait O13097:p.[Tyr296Phe;Tyr312Phe] Y296F/Y312F mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain Y F certain certain sequence position certain certain certain sequence position certain Y F This feature has been corrected as a result of our quality control procedures. The original label was 'Y296F/Y312F'. Wed May 02 18:32:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr296phe,tyr312phe' Tue Jun 30 18:38:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr296Phe;Tyr312Phe]' O13097:p.[Tyr296Phe;Tyr307Phe;Tyr312Phe] Y296F/Y307F/Y312F mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain Y F certain certain sequence position certain certain certain sequence position certain Y F certain certain sequence position certain certain certain sequence position certain Y F This feature has been corrected as a result of our quality control procedures. The original label was 'Y296F/Y307F/Y312F'. Wed May 02 18:35:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr296phe,tyr307phe,tyr312phe' Tue Jun 30 17:17:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr296Phe;Tyr307Phe;Tyr312Phe]' xenla Xenopus laevis (African clawed frog) African clawed frog physical association physical association lmo4_a-efnb1-1 2 23 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range xenla Xenopus laevis (African clawed frog) African clawed frog 21 unspecified role unspecified role prey prey xenla Xenopus laevis (African clawed frog) African clawed frog physical association physical association efnb1-stat3-3 9 24 unspecified role unspecified role bait bait human Homo sapiens Human 22 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association stat3-efnb1-1 10 22 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range xenla Xenopus laevis (African clawed frog) African clawed frog 21 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range xenla Xenopus laevis (African clawed frog) African clawed frog physical association physical association efnb2-stat3-1 4 16 unspecified role unspecified role bait bait xenla Xenopus laevis (African clawed frog) African clawed frog 22 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range xenla Xenopus laevis (African clawed frog) African clawed frog physical association physical association efnb1-stat1-1 7 20 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range xenla Xenopus laevis (African clawed frog) African clawed frog 21 unspecified role unspecified role bait bait xenla Xenopus laevis (African clawed frog) African clawed frog physical association physical association efnb1-stat5b-1 15 25 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range xenla Xenopus laevis (African clawed frog) African clawed frog 21 unspecified role unspecified role bait bait xenla Xenopus laevis (African clawed frog) African clawed frog physical association physical association efnb2-stat1-1 14 16 unspecified role unspecified role bait bait xenla Xenopus laevis (African clawed frog) African clawed frog 20 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range xenla Xenopus laevis (African clawed frog) African clawed frog physical association physical association efnb3-stat3-1 11 17 unspecified role unspecified role bait bait xenla Xenopus laevis (African clawed frog) African clawed frog 22 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range xenla Xenopus laevis (African clawed frog) African clawed frog physical association physical association efnb1-jak2-1 3 18 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range xenla Xenopus laevis (African clawed frog) African clawed frog 21 unspecified role unspecified role bait bait xenla Xenopus laevis (African clawed frog) African clawed frog physical association physical association efnb1-stat3-4 8 22 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P52631:p.Arg609Leu R609L mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain R L This feature has been corrected as a result of our quality control procedures. The original label was 'R609L'. Wed May 02 17:17:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg609leu' Tue Jun 30 17:40:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg609Leu' xenla Xenopus laevis (African clawed frog) African clawed frog 21 unspecified role unspecified role bait bait xenla Xenopus laevis (African clawed frog) African clawed frog physical association physical association efnb3-stat1-1 5 17 unspecified role unspecified role bait bait xenla Xenopus laevis (African clawed frog) African clawed frog 20 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range xenla Xenopus laevis (African clawed frog) African clawed frog physical association physical association efnb1-stat3-5 13 24 unspecified role unspecified role bait bait mouse Mus musculus Mouse 19 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association