DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Legionella pneumophila proteins that regulate Rab1 membrane cycling. Legionella pneumophila proteins that regulate Rab1 membrane cycling. Nature 2007 imex curation Ingmundson A., Delprato A., Lambright DG., Roy CR. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Ingmundson A., Delprato A., Lambright DG., Roy CR. DIP original experiment: DIP-253770X Nature 2007 IMEx Legionella pneumophila proteins that regulate Rab1 membrane cycling. Legionella pneumophila proteins that regulate Rab1 membrane cycling. Legionella pneumophila proteins that regulate Rab1 membrane cycling. Nature 2007 imex curation Ingmundson A., Delprato A., Lambright DG., Roy CR. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Ingmundson A., Delprato A., Lambright DG., Roy CR. DIP original experiment: DIP-253769X Nature 2007 IMEx Legionella pneumophila proteins that regulate Rab1 membrane cycling. q6x1y7_legpn C3927_12525 lepB protein protein legpn Legionella pneumophila MLIYQGKEIVRFKEKTGGKNKSDVDGFYKDNDGGKFFIKKPGDPRELFTELFAGLLLKEFMKRGLIDESYFPSLICADVIQFEDKSYGLIQPLVSFDELHKVIGTSSGDGKDRNTLKETLFGPGYYAGITKQNKYFGLSMALMFSLLLGAHSVHSGNIVVLNGEEKEKSKQFGRIDWGDAFRYFAHPNNNDNLLYAYENRGWFNYKSLTKDYFLNYKKINGLFPAMAEKARQLQSKLNPELLVKIVTSALKNIPADLIDEKTKIQLAAYMCMDSFKEATFGTEGNCKDFAIAMATLLENRLGKIAVLKDMSPLSNPEELYQSILELKPLTLLMTSSTSFSETINQWADILKTTDMEKFSFDSNPINLLELVKQFNLYVDELAITCEANNVWAKERIDSTPNLFALYDNSGGEAIHGHAFVPYYKESIVLRRLFTVDPNTFNLSRFAAFEGPCQLYCKEHKDSAWVKIQTLLTLGNGIINTLKIIKQAQAFGIDEAVTENLKALKEQFIAFQLAEADIKESLKAPSFAEPLPNKESEFFYPIDEKALAKMNGYQLATICLEELNSPKPSPLIERILSNKKFWKRINSAFESGVFKGRTDDPAGKIAKIREWHQLLQISGKKTAGQIDELQKIVISLQSKIKRQTIEFEELEATLIQIKEKYQLLEKMAEQSEHEKSSAQSIIRSLNLELSQLKLQLQEQEKLQFQLKELKEKIHEQTTLSKRLGEELQTQKKTNTHQEETIQRITKEKSLADSSLESLRKELHELAKKERSLHKTLEEKQLQVQQLEEQLAEKEKENLALKKADKQSQHEKSLDKSAIESLTSELNQLKLELQKQETLQLQLKSLRKQIQEQTLVVEGLKEELQKQKKSNTHQEETIERITKEKSLADSALESLRKEMYELTRKNEENQLKLTKQVHSLSEQLEEKQLQIREFEKQLQEKEKRVEQSEKGKASAKRTVASLREQVSNLKLQLQQLGEVIQEKEKGSSLISQQSKQIIALQEIIEDQKRQLEELKIKIQELVSANQELGKQNQSLSKENLHNKNTVEDLKKKLNELNVQLEQLHQSSNEKEQTIRKLREELIKKDSSLKQNEEMQLAQKHLQEEIDRLQKEIKQQQLNTNQLESIIAQSKEAEKRYQQALQQKKGIYFARMERVSPIYLQIQQIEQKAKELEERRETEASTAAKTLATKLRLEIKNYLDNNESDEKSALNSFKINAKRHIENSKETLNQHREEWKYLLANVTLGVFLLGIGYLAAILINKATTGNYTFFSQTNSGKKLDALEKAISSTHSETLVYG DIP protein Q6X1Y7 original sequence version: 14 p62820-1 Ras-related protein Rab-1A RAB1A RAB1 YPT1-related protein protein protein human Homo sapiens Human MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGCC DIP protein P62820-1 original sequence version: 108 DIP protein P62820-1 original sequence version: 78 rab1a-lepb-1 2 4 unspecified role unspecified role bait bait P62820-1:p.Gln70Leu Q70L mutation increasing strength mutation increasing interaction strength mutation increasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain Q L This feature has been corrected as a result of our quality control procedures. The original label was 'Q70L'. Wed May 02 14:33:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln70leu' Tue Jun 30 19:03:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln70Leu' GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 3 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association rab1a-lepb-2 1 4 unspecified role unspecified role bait bait P62820-1:p.Gln70Leu Q70L mutation increasing strength mutation increasing interaction strength mutation increasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain Q L This feature has been corrected as a result of our quality control procedures. The original label was 'Q70L'. Wed May 02 17:59:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln70leu' Tue Jun 30 17:03:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln70Leu' GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 3 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction