DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The EGF receptor is required for efficient liver regeneration. The EGF receptor is required for efficient liver regeneration. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Natarajan A., Wagner B., Sibilia M. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Natarajan A., Wagner B., Sibilia M. DIP original experiment: DIP-111399X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx The EGF receptor is required for efficient liver regeneration. ccnd1_mouse G1/S-specific cyclin-D1 Ccnd1 Cyl-1 protein protein mouse Mus musculus Mouse MEHQLLCCEVETIRRAYPDTNLLNDRVLRAMLKTEETCAPSVSYFKCVQKEIVPSMRKIVATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPLKKSRLQLLGATCMFVASKMKETIPLTAEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEADENKQTIRKHAQTFVALCATDVKFISNPPSMVAAGSVVAAMQGLNLGSPNNFLSCYRTTHFLSRVIKCDPDCLRACQEQIEALLESSLRQAQQNVDPKATEEEGEVEEEAGLACTPTDVRDVDI DIP protein P25322 original sequence version: 139 DIP protein P25322 original sequence version: 123 DIP protein P25322 original sequence version: 75 3A79736B4163251B cdk4_mouse Cyclin-dependent kinase 4 Cell division protein kinase 4 PSK-J3 CRK3 Cdk4 Crk3 protein protein mouse Mus musculus Mouse MAATRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGAAGGGLPVSTVREVALLRRLEAFEHPNVVRLMDVCATSRTDRDIKVTLVFEHIDQDLRTYLDKAPPPGLPVETIKDLMRQFLSGLDFLHANCIVHRDLKPENILVTSNGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPREVSLPRGAFAPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKEESDAE DIP protein P30285 original sequence version: 145 DIP protein P30285 original sequence version: 129 DIP protein P30285 original sequence version: 82 DIP protein P30285 original sequence version: 102 CB4F42A8AA13634A ccnd1-cdk4-17 1 3 unspecified role unspecified role prey prey mouse Mus musculus Mouse 2 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association