DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structure (London, England : 1993) 2007 imex curation Lorenzen K., Vannini A., Cramer P., Heck AJ. Only protein-protein interactions in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Lorenzen K., Vannini A., Cramer P., Heck AJ. DIP original experiment: DIP-67987X Structure (London, England : 1993) 2007 IMEx Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structure (London, England : 1993) 2007 imex curation Lorenzen K., Vannini A., Cramer P., Heck AJ. Only protein-protein interactions in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Lorenzen K., Vannini A., Cramer P., Heck AJ. DIP original experiment: DIP-67997X Structure (London, England : 1993) 2007 IMEx Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structure (London, England : 1993) 2007 imex curation Lorenzen K., Vannini A., Cramer P., Heck AJ. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Lorenzen K., Vannini A., Cramer P., Heck AJ. DIP original experiment: DIP-67980X Structure (London, England : 1993) 2007 IMEx Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structure (London, England : 1993) 2007 imex curation Lorenzen K., Vannini A., Cramer P., Heck AJ. Only protein-protein interactions in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Lorenzen K., Vannini A., Cramer P., Heck AJ. DIP original experiment: DIP-67988X Structure (London, England : 1993) 2007 IMEx Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structure (London, England : 1993) 2007 imex curation Lorenzen K., Vannini A., Cramer P., Heck AJ. Only protein-protein interactions in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Lorenzen K., Vannini A., Cramer P., Heck AJ. DIP original experiment: DIP-67992X Structure (London, England : 1993) 2007 IMEx Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structure (London, England : 1993) 2007 imex curation Lorenzen K., Vannini A., Cramer P., Heck AJ. Only protein-protein interactions in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Lorenzen K., Vannini A., Cramer P., Heck AJ. DIP original experiment: DIP-67996X Structure (London, England : 1993) 2007 IMEx Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structure (London, England : 1993) 2007 imex curation Lorenzen K., Vannini A., Cramer P., Heck AJ. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Lorenzen K., Vannini A., Cramer P., Heck AJ. DIP original experiment: DIP-67979X Structure (London, England : 1993) 2007 IMEx Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structure (London, England : 1993) 2007 imex curation Lorenzen K., Vannini A., Cramer P., Heck AJ. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Lorenzen K., Vannini A., Cramer P., Heck AJ. DIP original experiment: DIP-67991X Structure (London, England : 1993) 2007 IMEx Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structure (London, England : 1993) 2007 imex curation Lorenzen K., Vannini A., Cramer P., Heck AJ. Only protein-protein interactions in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Lorenzen K., Vannini A., Cramer P., Heck AJ. DIP original experiment: DIP-67983X Structure (London, England : 1993) 2007 IMEx Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structure (London, England : 1993) 2007 imex curation Lorenzen K., Vannini A., Cramer P., Heck AJ. Only protein-protein interactions in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Lorenzen K., Vannini A., Cramer P., Heck AJ. DIP original experiment: DIP-68001X Structure (London, England : 1993) 2007 IMEx Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structure (London, England : 1993) 2007 imex curation Lorenzen K., Vannini A., Cramer P., Heck AJ. Only protein-protein interactions in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Lorenzen K., Vannini A., Cramer P., Heck AJ. DIP original experiment: DIP-67998X Structure (London, England : 1993) 2007 IMEx Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structure (London, England : 1993) 2007 imex curation Lorenzen K., Vannini A., Cramer P., Heck AJ. Only protein-protein interactions in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Lorenzen K., Vannini A., Cramer P., Heck AJ. DIP original experiment: DIP-67990X Structure (London, England : 1993) 2007 IMEx Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structure (London, England : 1993) 2007 imex curation Lorenzen K., Vannini A., Cramer P., Heck AJ. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Lorenzen K., Vannini A., Cramer P., Heck AJ. DIP original experiment: DIP-67981X Structure (London, England : 1993) 2007 IMEx Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structure (London, England : 1993) 2007 imex curation Lorenzen K., Vannini A., Cramer P., Heck AJ. Only protein-protein interactions in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Lorenzen K., Vannini A., Cramer P., Heck AJ. DIP original experiment: DIP-68002X Structure (London, England : 1993) 2007 IMEx Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structure (London, England : 1993) 2007 imex curation Lorenzen K., Vannini A., Cramer P., Heck AJ. Only protein-protein interactions in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Lorenzen K., Vannini A., Cramer P., Heck AJ. DIP original experiment: DIP-68003X Structure (London, England : 1993) 2007 IMEx Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structure (London, England : 1993) 2007 imex curation Lorenzen K., Vannini A., Cramer P., Heck AJ. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Lorenzen K., Vannini A., Cramer P., Heck AJ. DIP original experiment: DIP-67982X Structure (London, England : 1993) 2007 IMEx Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structure (London, England : 1993) 2007 imex curation Lorenzen K., Vannini A., Cramer P., Heck AJ. Only protein-protein interactions in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Lorenzen K., Vannini A., Cramer P., Heck AJ. DIP original experiment: DIP-67993X Structure (London, England : 1993) 2007 IMEx Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structure (London, England : 1993) 2007 imex curation Lorenzen K., Vannini A., Cramer P., Heck AJ. Only protein-protein interactions in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Lorenzen K., Vannini A., Cramer P., Heck AJ. DIP original experiment: DIP-67984X Structure (London, England : 1993) 2007 IMEx Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structure (London, England : 1993) 2007 imex curation Lorenzen K., Vannini A., Cramer P., Heck AJ. Only protein-protein interactions in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Lorenzen K., Vannini A., Cramer P., Heck AJ. DIP original experiment: DIP-67999X Structure (London, England : 1993) 2007 IMEx Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structure (London, England : 1993) 2007 imex curation Lorenzen K., Vannini A., Cramer P., Heck AJ. Only protein-protein interactions in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Lorenzen K., Vannini A., Cramer P., Heck AJ. DIP original experiment: DIP-67994X Structure (London, England : 1993) 2007 IMEx Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structure (London, England : 1993) 2007 imex curation Lorenzen K., Vannini A., Cramer P., Heck AJ. Only protein-protein interactions in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Lorenzen K., Vannini A., Cramer P., Heck AJ. DIP original experiment: DIP-67989X Structure (London, England : 1993) 2007 IMEx Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structure (London, England : 1993) 2007 imex curation Lorenzen K., Vannini A., Cramer P., Heck AJ. Only protein-protein interactions in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Lorenzen K., Vannini A., Cramer P., Heck AJ. DIP original experiment: DIP-68000X Structure (London, England : 1993) 2007 IMEx Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structure (London, England : 1993) 2007 imex curation Lorenzen K., Vannini A., Cramer P., Heck AJ. Only protein-protein interactions in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Lorenzen K., Vannini A., Cramer P., Heck AJ. DIP original experiment: DIP-67995X Structure (London, England : 1993) 2007 IMEx Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structure (London, England : 1993) 2007 imex curation Lorenzen K., Vannini A., Cramer P., Heck AJ. Only protein-protein interactions in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Lorenzen K., Vannini A., Cramer P., Heck AJ. DIP original experiment: DIP-67986X Structure (London, England : 1993) 2007 IMEx Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. Structure (London, England : 1993) 2007 imex curation Lorenzen K., Vannini A., Cramer P., Heck AJ. Only protein-protein interactions in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Lorenzen K., Vannini A., Cramer P., Heck AJ. DIP original experiment: DIP-67985X Structure (London, England : 1993) 2007 IMEx Structural biology of RNA polymerase III: mass spectrometry elucidates subcomplex architecture. rpb1_yeast DNA-directed RNA polymerase II subunit RPB1 RPO21 RPB220 RPB1 SUA8 YDL140C D2150 DNA-directed RNA polymerase III largest subunit RNA polymerase II subunit B220 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVGQQYSSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRAKIGGLNDPRLGSIDRNLKCQTCQEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHNELMRQALAIKDSKKRFAAIWTLCKTKMVCETDVPSEDDPTQLVSRGGCGNTQPTIRKDGLKLVGSWKKDRATGDADEPELRVLSTEEILNIFKHISVKDFTSLGFNEVFSRPEWMILTCLPVPPPPVRPSISFNESQRGEDDLTFKLADILKANISLETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGRPVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHPGAKYVIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGVIPTPAIIKPKPLWSGKQILSVAIPNGIHLQRFDEGTTLLSPKDNGMLIIDGQIIFGVVEKKTVGSSNGGLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEKQSLDTIGGSDAAFEKRYRVDLLNTDHTLDPSLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNIRRIIQNAQQTFHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCCLLRSRLATRRVLQEYRLTKQAFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLEPGHAADQEQAKLIRSAIEHTTLKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRAAMNDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHMLKKIENTMLENITLRGVENIERVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGAFDVMIDEESLVKYMPEQKITEIEDGQDGGVTPYSNESGLVNADLDVKDELMFSPLVDSGSNDAMAGGFTAYGGADYGEATSPFGAYGEAPTSPGFGVSSPGFSPTSPTYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPSYSPTSPGYSPGSPAYSPKQDEQKHNENENSR A45C1360FF99F968 A45C1360FF99F968 rpb11_yeast DNA-directed RNA polymerase II subunit RPB11 YOL005C RPB11 DNA-directed RNA polymerase II 13.6 kDa polypeptide B13.6 protein protein yeast Saccharomyces cerevisiae Baker's yeast MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF A98D109C5FF8E356 A98D109C5FF8E356 rpab2_yeast DNA-directed RNA polymerases I, II, and III subunit RPABC2 RPO26 RPB6 YPR187W P9677.8 DNA-directed RNA polymerases I, II, and III 23 kDa polypeptide ABC23 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQHEQIRRKTLKEKAIPKDQRATTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL AA3DEF529F94A5E4 AA3DEF529F94A5E4 rpc6_yeast DNA-directed RNA polymerase III subunit RPC6 RPC34 YNR003C N2031 DNA-directed RNA polymerase III 36 kDa polypeptide C34 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSGMIENGLQLSDNAKTLHSQMMSKGIGALFTQQELQKQMGIGSLTDLMSIVQELLDKNLIKLVKQNDELKFQGVLESEAQKKATMSAEEALVYSYIEASGREGIWSKTIKARTNLHQHVVLKCLKSLESQRYVKSVKSVKFPTRKIYMLYSLQPSVDITGGPWFTDGELDIEFINSLLTIVWRFISENTFPNGFKNFENGPKKNVFYAPNVKNYSTTQEILEFITAAQVANVELTPSNIRSLCEVLVYDDKLEKVTHDCYRVTLESILQMNQGEGEPEAGNKALEDEEEFSIFNYFKMFPASKHDKEVVYFDEWTI BDE5CD6FD08BDA7F BDE5CD6FD08BDA7F rpc10_yeast DNA-directed RNA polymerase III subunit RPC10 RPC11 YDR045C YD9609.01C RNA polymerase III subunit C11 DNA-directed RNA polymerases III 12.5 kDa polypeptide protein protein yeast Saccharomyces cerevisiae Baker's yeast MLSFCPSCNNMLLITSGDSGVYTLACRSCPYEFPIEGIEIYDRKKLPRKEVDDVLGGGWDNVDQTKTQCPNYDTCGGESAYFFQLQIRSADEPMTTFYKCVNCGHRWKEN E4AA802EC9F92230 E4AA802EC9F92230 rpab4_yeast DNA-directed RNA polymerases I, II, and III subunit RPABC4 RPC10 RPB12 YHR143W-A YHR143BW ABC10-alpha protein protein yeast Saccharomyces cerevisiae Baker's yeast MSREGFQIPTNLDAAAAGTSQARTATLKYICAECSSKLSLSRTDAVRCKDCGHRILLKARTKRLVQFEAR 066A3D982EC7361E 066A3D982EC7361E rpac1_yeast DNA-directed RNA polymerases I and III subunit RPAC1 RPC40 YPR110C P8283.18 RPC5 DNA-directed RNA polymerases I and III 40 kDa polypeptide C37 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSNIVGIEYNRVTNTTSTDFPGFSKDAENEWNVEKFKKDFEVNISSLDAREANFDLINIDTSIANAFRRIMISEVPSVAAEYVYFFNNTSVIQDEVLAHRIGLVPLKVDPDMLTWVDSNLPDDEKFTDENTIVLSLNVKCTRNPDAPKGSTDPKELYNNAHVYARDLKFEPQGRQSTTFADCPVVPADPDILLAKLRPGQEISLKAHCILGIGGDHAKFSPVSTASYRLLPQINILQPIKGESARRFQKCFPPGVIGIDEGSDEAYVKDARKDTVSREVLRYEEFADKVKLGRVRNHFIFNVESAGAMTPEEIFFKSVRILKNKAEYLKNCPITQ 76A5D6784403E990 76A5D6784403E990 rpb3_yeast DNA-directed RNA polymerase II subunit RPB3 YIL021W RPB3 DNA-directed RNA polymerase II 45 kDa polypeptide B44.5 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVIVSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPVDQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPYSNASQMGNTGSGGYDNAW 8E1D1E6BB7B51D89 8E1D1E6BB7B51D89 rpab5_yeast DNA-directed RNA polymerases I, II, and III subunit RPABC5 YOR210W RPB10 ABC10-beta ABC8 DNA-directed RNA polymerases I, II, and III 8.3 kDa polypeptide protein protein yeast Saccharomyces cerevisiae Baker's yeast MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKRD E1F5733E8F466BE0 E1F5733E8F466BE0 rpb2_yeast DNA-directed RNA polymerase II subunit RPB2 YOR151C RPB2 RPB150 RPO22 DNA-directed RNA polymerase II 140 kDa polypeptide B150 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSDLANSEKYYDEDPYGFEDESAPITAEDSWAVISAFFREKGLVSQQLDSFNQFVDYTLQDIICEDSTLILEQLAQHTTESDNISRKYEISFGKIYVTKPMVNESDGVTHALYPQEARLRNLTYSSGLFVDVKKRTYEAIDVPGRELKYELIAEESEDDSESGKVFIGRLPIMLRSKNCYLSEATESDLYKLKECPFDMGGYFIINGSEKVLIAQERSAGNIVQVFKKAAPSPISHVAEIRSALEKGSRFISTLQVKLYGREGSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHICYDVNDWQMLEMLKPCVEDGFVIQDRETALDFIGRRGTALGIKKEKRIQYAKDILQKEFLPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDHFGKKRLDLAGPLLAQLFKTLFKKLTKDIFRYMQRTVEEAHDFNMKLAINAKTITSGLKYALATGNWGEQKKAMSSRAGVSQVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLSLMSCISVGTDPMPIITFLSEWGMEPLEDYVPHQSPDATRVFVNGVWHGVHRNPARLMETLRTLRRKGDINPEVSMIRDIREKELKIFTDAGRVYRPLFIVEDDESLGHKELKVRKGHIAKLMATEYQDIEGGFEDVEEYTWSSLLNEGLVEYIDAEEEESILIAMQPEDLEPAEANEENDLDVDPAKRIRVSHHATTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQKPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKKYGMSITETFEKPQRTNTLRMKHGTYDKLDDDGLIAPGVRVSGEDVIIGKTTPISPDEEELGQRTAYHSKRDASTPLRSTENGIVDQVLVTTNQDGLKFVKVRVRTTKIPQIGDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGNEGDASPFTDITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIHARARGPMQVLTRQPVEGRSRDGGLRFGEMERDCMIAHGAASFLKERLMEASDAFRVHICGICGLMTVIAKLNHNQFECKGCDNKIDIYQIHIPYAAKLLFQELMAMNITPRLYTDRSRDF BABD03212C0A583E BABD03212C0A583E rpab3_yeast DNA-directed RNA polymerases I, II, and III subunit RPABC3 RPB8 YOR224C YOR50-14 DNA-directed RNA polymerases I, II, and III 14.5 kDa polypeptide ABC14.5 ABC14.4 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLEDTPANDSSATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR 5B71693FE6FD8863 5B71693FE6FD8863 rpb9_yeast DNA-directed RNA polymerase II subunit RPB9 YGL070C RPB9 DNA-directed RNA polymerase II subunit 9 DNA-directed RNA polymerase II 14.2 kDa polypeptide B12.6 protein protein yeast Saccharomyces cerevisiae Baker's yeast MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS A80D69678A722881 A80D69678A722881 rpac2_yeast DNA-directed RNA polymerases I and III subunit RPAC2 YNL113W N1937 RPC19 DNA-directed RNA polymerases I and III 16 kDa polypeptide RPA19 AC19 protein protein yeast Saccharomyces cerevisiae Baker's yeast MTEDIEQKKTATEVTPQEPKHIQEEEEQDVDMTGDEEQEEEPDREKIKLLTQATSEDGTSASFQIVEEDHTLGNALRYVIMKNPDVEFCGYSIPHPSENLLNIRIQTYGETTAVDALQKGLKDLMDLCDVVESKFTEKIKSM 0B048299A787EEDB 0B048299A787EEDB rpc8_yeast DNA-directed RNA polymerase III subunit RPC8 RPC25 YKL144C YKL1 UNF1 RNA polymerase III subunit C25 DNA-directed RNA polymerase III 25 kDa polypeptide protein protein yeast Saccharomyces cerevisiae Baker's yeast MFILSKIADLVRIPPDQFHRDTISAITHQLNNKFANKIIPNVGLCITIYDLLTVEEGQLKPGDGSSYINVTFRAVVFKPFLGEIVTGWISKCTAEGIKVSLLGIFDDIFIPQNMLFEGCYYTPEESAWIWPMDEETKLYFDVNEKIRFRIEREVFVDVKPKSPKERELEERAQLENEIEGKNEETPQNEKPPAYALLGSCQTDGMGLVSWWE 7A2422D5B0CEEEC5 7A2422D5B0CEEEC5 rpb7_yeast DNA-directed RNA polymerase II subunit RPB7 RPB7 YDR404C D9509.22 B16 protein protein yeast Saccharomyces cerevisiae Baker's yeast MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI 44C85603A93CDE67 44C85603A93CDE67 rpc9_yeast DNA-directed RNA polymerase III subunit RPC9 YJL011C J1349 RPC17 RNA polymerase III subunit C17 protein protein yeast Saccharomyces cerevisiae Baker's yeast MKVLEERNAFLSDYEVLKFLTDLEKKHLWDQKSLAALKKSRSKGKQNRPYNHPELQGITRNVVNYLSINKNFINQEDEGEERESSGAKDAEKSGISKMSDESFAELMTKLNSFKLFKAEKLQIVNQLPANMVHLYSIVEECDARFDEKTIEEMLEIISGYA BA1FF62FE3676C51 BA1FF62FE3676C51 rpb4_yeast DNA-directed RNA polymerase II subunit RPB4 RPB4 YJL140W J0654 DNA-directed RNA polymerase II 32 kDa polypeptide B32 protein protein yeast Saccharomyces cerevisiae Baker's yeast MNVSTSTFQTRRRRLKKVEEEENAATLQLGQEFQLKQINHQGEEEELIALNLSEARLVIKEALVERRRAFKRSQKKHKKKHLKHENANDETTAVEDEDDDLDEDDVNADDDDFMHSETREKELESIDVLLEQTTGGNNKDLKNTMQYLTNFSRFRDQETVGAVIQLLKSTGLHPFEVAQLGSLACDTADEAKTLIPSLNNKISDDELERILKELSNLETLY 72A8A26871B87775 72A8A26871B87775 rpc3_yeast DNA-directed RNA polymerase III subunit RPC3 RPC82 RPC3 YPR190C P9677.11 DNA-directed III 74 kDa polypeptide C82 protein protein yeast Saccharomyces cerevisiae Baker's yeast MDELLGEALSAENQTGESTVESEKLVTPEDVMTISSLEQRTLNPDLFLYKELVKAHLGERAASVIGMLVALGRLSVRELVEKIDGMDVDSVKTTLVSLTQLRCVKYLQETAISGKKTTYYYYNEEGIHILLYSGLIIDEIITQMRVNDEEEHKQLVAEIVQNVISLGSLTVEDYLSSVTSDSMKYTISSLFVQLCEMGYLIQISKLHYTPIEDLWQFLYEKHYKNIPRNSPLSDLKKRSQAKMNAKTDFAKIINKPNELSQILTVDPKTSLRIVKPTVSLTINLDRFMKGRRSKQLINLAKTRVGSVTAQVYKIALRLTEQKSPKIRDPLTQTGLLQDLEEAKSFQDEAELVEEKTPGLTFNAIDLARHLPAELDLRGSLLSRKPSDNKKRSGSNAAASLPSKKLKTEDGFVIPALPAAVSKSLQESGDTQEEDEEEEDLDADTEDPHSASLINSHLKILASSNFPFLNETKPGVYYVPYSKLMPVLKSSVYEYVIASTLGPSAMRLSRCIRDNKLVSEKIINSTALMKEKDIRSTLASLIRYNSVEIQEVPRTADRSASRAVFLFRCKETHSYNFMRQNLEWNMANLLFKKEKLKQENSTLLKKANRDDVKGRENELLLPSELNQLKMVNERELNVFARLSRLLSLWEVFQMA B39FA74F4A18BADE B39FA74F4A18BADE rpc7_yeast DNA-directed RNA polymerase III subunit RPC7 RPC31 ACP2 RPC8 YNL151C N1769 DNA-directed RNA polymerase III 31 kDa polypeptide protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSYRGGSRGGGSNYMSNLPFGLGYGDVGKNHITEFPSIPLPINGPITNKERSLAVKYINFGKTVKDGPFYTGSMSLIIDQQENSKSGKRKPNIILDEDDTNDGIERYSDKYLKKRKIGISIDDHPYNLNLFPNELYNVMGINKKKLLAISKFNNADDVFTGTGLQDENIGLSMLAKLKELAEDVDDASTGDGAAKGSKTGEGEDDDLADDDFEEDEDEEDDDDYNAEKYFNNGDDDDYGDEEDPNEEAAF 33A7D8EAE47793E1 33A7D8EAE47793E1 rpc5_yeast DNA-directed RNA polymerase III subunit RPC5 YKR025W RNA polymerase III subunit C37 DNA-directed RNA polymerase III 37 kDa polypeptide RPC37 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSIDNKLFVTEEDEEDRTQDRADVEDESNDIDMIADENGTNSAIANEQEEKSEEVKAEDDTGEEEEDDPVIEEFPLKISGEEESLHVFQYANRPRLVGRKPAEHPFISAARYKPKSHLWEIDIPLDEQAFYNKDKAESEWNGVNVQTLKGVGVENNGQYAAFVKDMQVYLVPIERVAQLKPFFKYIDDANVTRKQEDARRNPNPSSQRAQVVTMSVKSVNDPSQNRLTGSLLAHKVADEEANIELTWAEGTFEQFKDTIVKEAEDKTLVALEKQEDYIDNLV 9E948BDDECE9D15E 9E948BDDECE9D15E rpc1_yeast DNA-directed RNA polymerase III subunit RPC1 RPO31 RPC160 RPC1 YOR116C O3254 YOR3254C DNA-directed RNA polymerase III largest subunit RNA polymerase III subunit C160 protein protein yeast Saccharomyces cerevisiae Baker's yeast MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGVSSSSLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDKRQFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCGALNGVVKKAAAGAGSAALKIIHDTFRWVGKKSAPEKDIWVGEWKEVLAHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCELLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELIVNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEHFDIPPPAIMKPYYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPNEMSQNDGFVIIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPADDLKQKKEELVEIAYHKCDELITLFNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGDVCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNQDKGLLPYAIMETANEILGPLEERLVRYDNSGCLVKREDLNKAEYVDQYDAERDFYHSLREYINGKATALANLRKSRGMLGLLEPPAKELQGIDPDETVPDNVKTSVSQLYRISEKSVRKFLEIALFKYRKARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVLVNDNDERAARVVKGRVEKTLLSDVAFYVQDVYKDNLSFIQVRIDLGTIDKLQLELTIEDIAVAITRASKLKIQASDVNIIGKDRIAINVFPEGYKAKSISTSAKEPSENDVFYRMQQLRRALPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSRTTTNHVLEVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEKDLVPKRCLFESLSNEAALKAN D1697EB2352BCA4F D1697EB2352BCA4F rpab1_yeast DNA-directed RNA polymerases I, II, and III subunit RPABC1 RPB5 YBR154C YBR1204 RPA7 RPC9 DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide ABC27 protein protein yeast Saccharomyces cerevisiae Baker's yeast MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSFQANPTEESISKFPDMGSLWVEFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSAMKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDEKRELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM 2A15F7114D69D829 2A15F7114D69D829 rpc4_yeast DNA-directed RNA polymerase III subunit RPC4 RPC53 RPC4 YDL150W D1557 DNA-directed RNA polymerase III 47 kDa polypeptide C53 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSNKGNGRLPSLKDSSSNGGGSAKPSLKFKPKAVARKSKEEREAAASKVKLEEESKRGNDKKHFNNKNKRVTGAGGQQRRMAKYLNNTHVISSGPLAAGNFVSEKGDLRRGFIKSEGSGSSLVQKGLETIDNGAESSENEAEDDDNEGVASKSKKKFNMGKEFEARNLIEDEDDGESEKSSDVDMDDEEWRSKRIEQLFPVRPVRVRHEDVETVKREIQEALSEKPTREPTPSVKTEPVGTGLQSYLEERERQVNEKLADLGLEKEFQSVDGKEAAAELELLNADHQHILRKLKKMNNKPERFMVFQLPTRLPAFERPAVKEEKEDMETQASDPSKKKKNIKKKDTKDALSTRELAGKVGSIRVHKSGKLSVKIGNVVMDIGKGAETTFLQDVIALSIADDASSAELLGRVDGKIVVTPQI 206FBAC274BC72D5 206FBAC274BC72D5 rpc2_yeast DNA-directed RNA polymerase III subunit RPC2 YOR207C RET1 RPC2 RPC128 DNA-directed RNA polymerase III 130 kDa polypeptide C128 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVAATKRRKTHIHKHVKDEAFDDLLKPVYKGKKLTDEINTAQDKWHLLPAFLKVKGLVKQHLDSFNYFVDTDLKKIIKANQLILSDVDPEFYLKYVDIRVGKKSSSSTKDYLTPPHECRLRDMTYSAPIYVDIEYTRGRNIIMHKDVEIGRMPIMLRSNKCILYDADESKMAKLNECPLDPGGYFIVNGTEKVILVQEQLSKNRIIVEADEKKGIVQASVTSSTHERKSKTYVITKNGKIYLKHNSIAEEIPIAIVLKACGILSDLEIMQLVCGNDSSYQDIFAVNLEESSKLDIYTQQQALEYIGAKVKTMRRQKLTILQEGIEAIATTVIAHLTVEALDFREKALYIAMMTRRVVMAMYNPKMIDDRDYVGNKRLELAGQLISLLFEDLFKKFNNDFKLSIDKVLKKPNRAMEYDALLSINVHSNNITSGLNRAISTGNWSLKRFKMERAGVTHVLSRLSYISALGMMTRISSQFEKSRKVSGPRALQPSQFGMLCTADTPEGEACGLVKNLALMTHITTDDEEEPIKKLCYVLGVEDITLIDSASLHLNYGVYLNGTLIGSIRFPTKFVTQFRHLRRTGKVSEFISIYSNSHQMAVHIATDGGRICRPLIIVSDGQSRVKDIHLRKLLDGELDFDDFLKLGLVEYLDVNEENDSYIALYEKDIVPSMTHLEIEPFTILGAVAGLIPYPHHNQSPRNTYQCAMGKQAIGAIAYNQFKRIDTLLYLMTYPQQPMVKTKTIELIDYDKLPAGQNATVAVMSYSGYDIEDALVLNKSSIDRGFGRCETRRKTTTVLKRYANHTQDIIGGMRVDENGDPIWQHQSLGPDGLGEVGMKVQSGQIYINKSVPTNSADAPNPNNVNVQTQYREAPVIYRGPEPSHIDQVMMSVSDNDQALIKVLLRQNRRPELGDKFSSRHGQKGVCGIIVKQEDMPFNDQGIVPDIIMNPHGFPSRMTVGKMIELISGKAGVLNGTLEYGTCFGGSKLEDMSKILVDQGFNYSGKDMLYSGITGECLQAYIFFGPIYYQKLKHMVLDKMHARARGPRAVLTRQPTEGRSRDGGLRLGEMERDCVIAYGASQLLLERLMISSDAFEVDVCDKCGLMGYSGWCTTCKSAENIIKMTIPYAAKLLFQELLSMNIAPRLRLEDIFQQ 6AC52354F34CF090 6AC52354F34CF090 c34-rpb8-1 10 29 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 36 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction rpb12-rpb4-1 24 31 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 37 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 36 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 40 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 28 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 47 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 42 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association c17-rpb10-1 15 34 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 41 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction rpb4-rpb7-3 18 40 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 42 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction rpb10-rpb11-7 5 27 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 34 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 37 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 36 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association rpb11-rpb12-1 20 47 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 31 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 27 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association ac19-ac40-1 13 32 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 38 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 46 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 49 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 43 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 48 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 45 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 29 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 44 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 39 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 41 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 30 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 31 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 34 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 36 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 28 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 47 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association rpb11-rpb8-1 2 27 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 36 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction c11-c17-1 25 43 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 45 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 29 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 39 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 41 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 30 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 31 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 36 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 28 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 47 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association rpb10-rpb12-1 21 34 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 31 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 40 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 42 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association rpb8-rpb9-1 6 37 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 36 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction c17-c34-1 11 41 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 29 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction ac19-ac40-2 16 32 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 38 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 46 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 49 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 43 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 29 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 44 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 39 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 41 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 30 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 31 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 34 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 36 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 28 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 47 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association c17-c25-1 9 39 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 41 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction rpb1-rpb10-1 7 31 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 27 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 34 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 37 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 36 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 40 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 28 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 47 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 42 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 33 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 35 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 26 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association c17-rpb8-1 14 41 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 36 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction ac40-rpb8-1 22 36 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 32 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction rpb10-rpb11-8 12 31 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 27 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 34 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 37 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 36 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 47 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association c34-c82-1 1 43 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 29 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction ac40-c17-1 19 32 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 41 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction rpb1-rpb10-2 3 31 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 27 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 34 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 37 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 36 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 28 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 47 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 33 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 35 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 26 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association rpb5-rpb8-1 23 36 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 47 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction ac19-ac40-3 4 32 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 38 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 43 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 29 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 39 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 41 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 31 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 34 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 36 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association rpb11-rpb12-2 17 31 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 27 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 37 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 36 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association ac19-ac40-4 8 32 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 38 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 46 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 49 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 43 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 45 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 29 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 44 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 39 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 41 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 30 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 31 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 34 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 36 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 28 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 47 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association