DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Conformational dynamics of the KcsA potassium channel governs gating properties. Conformational dynamics of the KcsA potassium channel governs gating properties. Nature structural & molecular biology 2007 imex curation Baker KA., Tzitzilonis C., Kwiatkowski W., Choe S., Riek R. Only protein-protein interactions ecolx Escherichia coli comigration in sds comigration in sds page comigration in sds predetermined predetermined participant predetermined Baker KA., Tzitzilonis C., Kwiatkowski W., Choe S., Riek R. DIP original experiment: DIP-68102X Nature structural & molecular biology 2007 IMEx Conformational dynamics of the KcsA potassium channel governs gating properties. Conformational dynamics of the KcsA potassium channel governs gating properties. Conformational dynamics of the KcsA potassium channel governs gating properties. Nature structural & molecular biology 2007 imex curation Baker KA., Tzitzilonis C., Kwiatkowski W., Choe S., Riek R. Only protein-protein interactions ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Baker KA., Tzitzilonis C., Kwiatkowski W., Choe S., Riek R. DIP original experiment: DIP-68103X Nature structural & molecular biology 2007 IMEx Conformational dynamics of the KcsA potassium channel governs gating properties. kcsa_strli pH-gated potassium channel KcsA Streptomyces lividans K+ channel kcsA skc1 protein protein strli Streptomyces lividans MPPMLSGLLARLVKLLLGRHGSALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERRGHFVRHSEKAAEEAYTRTTRALHERFDRLERMLDDNRR DIP protein P0A334 original sequence version: 27 DIP protein P0A334 original sequence version: 30 DIP protein P0A334 original sequence version: 31 DIP protein P0A334 original sequence version: 40 DIP protein P0A334 original sequence version: 36 DIP protein P0A334 original sequence version: 39 DIP protein P0A334 original sequence version: 48 DIP protein P0A334 original sequence version: 66 mint DEBD9E64384BF40C kcsa-2 1 3 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli direct interaction direct interaction kcsa-3 2 3 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli direct interaction direct interaction