DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Interaction between the keratin cytoskeleton and eEF1Bgamma affects protein synthesis in epithelial cells. Interaction between the keratin cytoskeleton and eEF1Bgamma affects protein synthesis in epithelial cells. Nature structural & molecular biology 2007 imex curation Kim S., Kellner J., Lee CH., Coulombe PA. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kim S., Kellner J., Lee CH., Coulombe PA. DIP original experiment: DIP-255106X Nature structural & molecular biology 2007 IMEx Interaction between the keratin cytoskeleton and eEF1Bgamma affects protein synthesis in epithelial cells. Interaction between the keratin cytoskeleton and eEF1Bgamma affects protein synthesis in epithelial cells. Interaction between the keratin cytoskeleton and eEF1Bgamma affects protein synthesis in epithelial cells. Nature structural & molecular biology 2007 imex curation Kim S., Kellner J., Lee CH., Coulombe PA. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kim S., Kellner J., Lee CH., Coulombe PA. DIP original experiment: DIP-255107X Nature structural & molecular biology 2007 IMEx Interaction between the keratin cytoskeleton and eEF1Bgamma affects protein synthesis in epithelial cells. Interaction between the keratin cytoskeleton and eEF1Bgamma affects protein synthesis in epithelial cells. Interaction between the keratin cytoskeleton and eEF1Bgamma affects protein synthesis in epithelial cells. Nature structural & molecular biology 2007 imex curation Kim S., Kellner J., Lee CH., Coulombe PA. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Kim S., Kellner J., Lee CH., Coulombe PA. DIP original experiment: DIP-255110X Nature structural & molecular biology 2007 IMEx Interaction between the keratin cytoskeleton and eEF1Bgamma affects protein synthesis in epithelial cells. Interaction between the keratin cytoskeleton and eEF1Bgamma affects protein synthesis in epithelial cells. Interaction between the keratin cytoskeleton and eEF1Bgamma affects protein synthesis in epithelial cells. Nature structural & molecular biology 2007 imex curation Kim S., Kellner J., Lee CH., Coulombe PA. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kim S., Kellner J., Lee CH., Coulombe PA. DIP original experiment: DIP-255109X Nature structural & molecular biology 2007 IMEx Interaction between the keratin cytoskeleton and eEF1Bgamma affects protein synthesis in epithelial cells. Interaction between the keratin cytoskeleton and eEF1Bgamma affects protein synthesis in epithelial cells. Interaction between the keratin cytoskeleton and eEF1Bgamma affects protein synthesis in epithelial cells. Nature structural & molecular biology 2007 imex curation Kim S., Kellner J., Lee CH., Coulombe PA. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kim S., Kellner J., Lee CH., Coulombe PA. DIP original experiment: DIP-255108X Nature structural & molecular biology 2007 IMEx Interaction between the keratin cytoskeleton and eEF1Bgamma affects protein synthesis in epithelial cells. k1c17_mouse Keratin, type I cytoskeletal 17 Krt17 Krt1-17 Keratin-17 Cytokeratin-17 protein protein mouse Mus musculus Mouse MTTTIRQFTSSSSIKGSSGLGGGSSRTSCRLSGSLGAGSCRLGSASGLGSALGSNSYSSCYSFGTGSGYGGNFGGVDGLLAGGEKATMQNLNDRLASYLDKVRALEEANTELEVKIRDWYQKQAPGPARDYSAYYHTIEDLKNKILVATVDNASILLQIDNARLAADDFRTKFETEQALRMSVEADINGLRRVLDELTLARADLEMQIENLKEELAYLKKNHEEEMNALRGQVGGEINVEMDAAPGVDLSRILSEMRDQYEKMAEKNRKDAEDWFFSKTEELNREVATNSELVQSGKSEISELRRTMQALEIELQSQLSMKASLEGSLAETENRYCVQLSQIQGLIGSVEEQLAQLRCEMEQQNQEYKILLDVKTRLEQEIATYRRLLEGEDAHLTQYKPKEPVTTRQVRTIVEEVQDGKVISSREQVHQTTR DIP protein Q9QWL7 original sequence version: 106 279081DF2ECE105D ef1a1_mouse Elongation factor 1-alpha 1 Eukaryotic elongation factor 1 A-1 Elongation factor Tu Eef1a1 Eef1a protein protein mouse Mus musculus Mouse MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGSASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVDKKAAGAGKVTKSAQKAQKAK DIP protein P10126 original sequence version: 149 71072871DE7405DC k1c17_human Keratin, type I cytoskeletal 17 KRT17 Cytokeratin-17 39.1 Keratin-17 protein protein human Homo sapiens Human MTTSIRQFTSSSSIKGSSGLGGGSSRTSCRLSGGLGAGSCRLGSAGGLGSTLGGSSYSSCYSFGSGGGYGSSFGGVDGLLAGGEKATMQNLNDRLASYLDKVRALEEANTELEVKIRDWYQRQAPGPARDYSQYYRTIEELQNKILTATVDNANILLQIDNARLAADDFRTKFETEQALRLSVEADINGLRRVLDELTLARADLEMQIENLKEELAYLKKNHEEEMNALRGQVGGEINVEMDAAPGVDLSRILNEMRDQYEKMAEKNRKDAEDWFFSKTEELNREVATNSELVQSGKSEISELRRTMQALEIELQSQLSMKASLEGNLAETENRYCVQLSQIQGLIGSVEEQLAQLRCEMEQQNQEYKILLDVKTRLEQEIATYRRLLEGEDAHLTQYKKEPVTTRQVRTIVEEVQDGKVISSREQVHQTTR DIP protein Q04695 original sequence version: 143 35B429243F47EB5C ef1g_mouse Elongation factor 1-gamma eEF-1B gamma Eef1g protein protein mouse Mus musculus Mouse MAAGTLYTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVFESNAIAYYVSNEELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHHNKQATENAKEEVKRILGLLDTHLKTRTFLVGERVTLADITVVCTLLWLYKQVLEPSFRQAFPNTNRWFLTCINQPQFRAILGEVKLCEKMAQFDAKKFAESQPKKDTPRKEKGSREEKQKPQAERKEEKKAAAPAPEEEMDECEQALAAEPKAKDPFAHLPKSTFVLDEFKRKYSNEDTLSVALPYFWEHFDKDGWSLWYAEYRFPEELTQTFMSCNLITGMFQRLDKLRKNAFASVILFGTNNSSSISGVWVFRGQELAFPLSPDWQVDYESYTWRKLDPGSEETQTLVREYFSWEGTFQHVGKAVNQGKIFK DIP protein Q9D8N0 original sequence version: 114 403A9C0E95E27454 ef1b_mouse Elongation factor 1-beta Eef1b Eef1b2 protein protein mouse Mus musculus Mouse MGFGDLKTPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSGPPPADLCHALRWYNHIKSYEKEKASLPGVKKSLGKYGPSSVEDTTGSGAADAKDDDDIDLFGSDDEEESEEAKKLREERLAQYESKKAKKPAVVAKSSILLDVKPWDDETDMTKLEECVRSIQADGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGTDMLEEQITAFEDYVQSMDVAAFNKI DIP protein O70251 original sequence version: 112 6E497150AD88F887 ef1g_human Elongation factor 1-gamma PRO1608 EEF1G EF1G eEF-1B gamma protein protein human Homo sapiens Human MAAGTLYTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVFESNAIAYYVSNEELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHHNKQATENAKEEVRRILGLLDAYLKTRTFLVGERVTLADITVVCTLLWLYKQVLEPSFRQAFPNTNRWFLTCINQPQFRAVLGEVKLCEKMAQFDAKKFAETQPKKDTPRKEKGSREEKQKPQAERKEEKKAAAPAPEEEMDECEQALAAEPKAKDPFAHLPKSTFVLDEFKRKYSNEDTLSVALPYFWEHFDKDGWSLWYSEYRFPEELTQTFMSCNLITGMFQRLDKLRKNAFASVILFGTNNSSSISGVWVFRGQELAFPLSPDWQVDYESYTWRKLDPGSEETQTLVREYFSWEGAFQHVGKAFNQGKIFK DIP protein P26641 original sequence version: 155 A6110663110CF3FC eef1g-eef1a1-1 1 10 unspecified role unspecified role prey prey mouse Mus musculus Mouse 7 unspecified role unspecified role prey prey mouse Mus musculus Mouse 6 unspecified role unspecified role prey prey mouse Mus musculus Mouse 9 unspecified role unspecified role bait bait mouse Mus musculus Mouse association association krt17-eef1g-1 3 9 unspecified role unspecified role prey prey Region 185-223 Region 185-223 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 8 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association krt17-eef1g-2 5 11 unspecified role unspecified role prey prey human Homo sapiens Human 8 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association eef1g-krt17-1 4 11 unspecified role unspecified role bait bait human Homo sapiens Human 8 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association krt17-eef1a1-1 2 10 unspecified role unspecified role prey prey mouse Mus musculus Mouse 7 unspecified role unspecified role prey prey mouse Mus musculus Mouse 6 unspecified role unspecified role bait bait mouse Mus musculus Mouse 9 unspecified role unspecified role prey prey mouse Mus musculus Mouse association association