DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Protein pyrophosphorylation by inositol pyrophosphates is a posttranslational event. Protein pyrophosphorylation by inositol pyrophosphates is a posttranslational event. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Bhandari R., Saiardi A., Ahmadibeni Y., Snowman AM., Resnick AC., Kristiansen TZ., Molina H., Pandey A., Werner JK., Juluri KR., Xu Y., Prestwich GD., Parang K., Snyder SH. Only protein-protein interactions in vitro In vitro phosphatase assay phosphatase assay predetermined predetermined participant predetermined Bhandari R., Saiardi A., Ahmadibeni Y., Snowman AM., Resnick AC., Kristiansen TZ., Molina H., Pandey A., Werner JK., Juluri KR., Xu Y., Prestwich GD., Parang K., Snyder SH. DIP original experiment: DIP-113815X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Protein pyrophosphorylation by inositol pyrophosphates is a posttranslational event. Protein pyrophosphorylation by inositol pyrophosphates is a posttranslational event. Protein pyrophosphorylation by inositol pyrophosphates is a posttranslational event. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Bhandari R., Saiardi A., Ahmadibeni Y., Snowman AM., Resnick AC., Kristiansen TZ., Molina H., Pandey A., Werner JK., Juluri KR., Xu Y., Prestwich GD., Parang K., Snyder SH. Only protein-protein interactions in vitro In vitro comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel ms participant Identification by mass spectrometry ms participant Bhandari R., Saiardi A., Ahmadibeni Y., Snowman AM., Resnick AC., Kristiansen TZ., Molina H., Pandey A., Werner JK., Juluri KR., Xu Y., Prestwich GD., Parang K., Snyder SH. DIP original experiment: DIP-113816X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Protein pyrophosphorylation by inositol pyrophosphates is a posttranslational event. pp_lambd Serine/threonine-protein phosphatase protein protein lambd Enterobacteria phage lambda Bacteriophage lambda MRYYEKIDGSKYRNIWVVGDLHGCYTNLMNKLDTIGFDNKKDLLISVGDLVDRGAENVECLELITFPWFRAVRGNHEQMMIDGLSERGNVNHWLLNGGGWFFNLDYDKEILAKALAHKADELPLIIELVSKDKKYVICHADYPFDEYEFGKPVDHQQVIWNRERISNSQNGIVKEIKGADTFIFGHTPAVKPLKFANQMYIDTGAVFCGNLTLIQVQGEGA DIP protein P03772 original sequence version: 71 5CE0E1A0F3BC5CB5 q8c000_mouse LisH domain-containing protein Gm5124 EG331392 protein protein mouse Mus musculus Mouse MADTGLRRVVPSDLYPLVLGFLRDNQLSEVASKFAKATGATQQDANASSLLDIYSFWLKSTKAPTMKLQSNRPVTKKVKKETSSSDSSEDSSEEEDKAQGLSTQKAAAPAKRAGVPQRAGKAAAKASESSSSEESSDDEEEEDKTKKPVQQKAVKPQAKAARPPPKKAESCESESDSSSEDEAPQTQKPKTAVAAKAPTKAAAKQATPAKAQPKVANDKAARSHSRRRCHSSSSSSNSSDGSQEEKAAAPPKKTAPKKQVVAKAPVKVAAAPTQKSSSSEDSSSEEGEERKKPMKKKAGPYSSLPPPSVPLPKKSSSGTQAPKKAAAQTRPADSSDESDSSSEEEKKPPAKTVVSKTPAKPAPVKKKAESSSDSSDSDSSEDEAPAKPASTTKSPLSKPAVTPKPSAAKAVATPKQPAGGGQKAQSRKANSSSSEEEEEEEERREKGRGKGRGRRQNSEVGRGLSRTVLS DIP protein Q8C000 original sequence version: 34 mint F628911EA3FC59C5 nsr1_yeast Nuclear localization sequence-binding protein NSR1 YGR159C G7001 p67 protein protein yeast Saccharomyces cerevisiae Baker's yeast MAKTTKVKGNKKEVKASKQAKEEKAKAVSSSSSESSSSSSSSSESESESESESESSSSSSSSDSESSSSSSSDSESEAETKKEESKDSSSSSSDSSSDEEEEEEKEETKKEESKESSSSDSSSSSSSDSESEKEESNDKKRKSEDAEEEEDEESSNKKQKNEETEEPATIFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTDRSRGYGYVDFENKSYAEKAIQEMQGKEIDGRPINCDMSTSKPAGNNDRAKKFGDTPSEPSDTLFLGNLSFNADRDAIFELFAKHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDALQGEYIDNRPVRLDFSSPRPNNDGGRGGSRGFGGRGGGRGGNRGFGGRGGARGGRGGFRPSGSGANTAPLGRSRNTASFAGSKKTFD 90DEEE7BBC20BC0C 90DEEE7BBC20BC0C nsr1-pp_lambd-1 1 3 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli 5 enzyme target enzyme target substrate substrate unspecified role unspecified role Region 1-50 Region 1-50 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction gm5124-1 2 4 unspecified role unspecified role unspecified role unspecified role Region 76-100 Region 76-100 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain in vitro In vitro direct interaction direct interaction