DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structure-function relationship of CAP-Gly domains. Structure-function relationship of CAP-Gly domains. Nature structural & molecular biology 2007 imex curation Weisbrich A., Honnappa S., Jaussi R., Okhrimenko O., Frey D., Jelesarov I., Akhmanova A., Steinmetz MO. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Weisbrich A., Honnappa S., Jaussi R., Okhrimenko O., Frey D., Jelesarov I., Akhmanova A., Steinmetz MO. DIP original experiment: DIP-255094X Nature structural & molecular biology 2007 IMEx Structure-function relationship of CAP-Gly domains. Structure-function relationship of CAP-Gly domains. Structure-function relationship of CAP-Gly domains. Nature structural & molecular biology 2007 imex curation Weisbrich A., Honnappa S., Jaussi R., Okhrimenko O., Frey D., Jelesarov I., Akhmanova A., Steinmetz MO. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Weisbrich A., Honnappa S., Jaussi R., Okhrimenko O., Frey D., Jelesarov I., Akhmanova A., Steinmetz MO. DIP original experiment: DIP-255096X Nature structural & molecular biology 2007 IMEx Structure-function relationship of CAP-Gly domains. Structure-function relationship of CAP-Gly domains. Structure-function relationship of CAP-Gly domains. Nature structural & molecular biology 2007 imex curation Weisbrich A., Honnappa S., Jaussi R., Okhrimenko O., Frey D., Jelesarov I., Akhmanova A., Steinmetz MO. Only protein-protein interactions in vitro In vitro sls static light scattering sls predetermined predetermined participant predetermined Weisbrich A., Honnappa S., Jaussi R., Okhrimenko O., Frey D., Jelesarov I., Akhmanova A., Steinmetz MO. DIP original experiment: DIP-255095X Nature structural & molecular biology 2007 IMEx Structure-function relationship of CAP-Gly domains. Structure-function relationship of CAP-Gly domains. Structure-function relationship of CAP-Gly domains. Nature structural & molecular biology 2007 imex curation Weisbrich A., Honnappa S., Jaussi R., Okhrimenko O., Frey D., Jelesarov I., Akhmanova A., Steinmetz MO. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Weisbrich A., Honnappa S., Jaussi R., Okhrimenko O., Frey D., Jelesarov I., Akhmanova A., Steinmetz MO. DIP original experiment: DIP-255090X Nature structural & molecular biology 2007 IMEx Structure-function relationship of CAP-Gly domains. Structure-function relationship of CAP-Gly domains. Structure-function relationship of CAP-Gly domains. Nature structural & molecular biology 2007 imex curation Weisbrich A., Honnappa S., Jaussi R., Okhrimenko O., Frey D., Jelesarov I., Akhmanova A., Steinmetz MO. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Weisbrich A., Honnappa S., Jaussi R., Okhrimenko O., Frey D., Jelesarov I., Akhmanova A., Steinmetz MO. DIP original experiment: DIP-255093X Nature structural & molecular biology 2007 IMEx Structure-function relationship of CAP-Gly domains. Structure-function relationship of CAP-Gly domains. Structure-function relationship of CAP-Gly domains. Nature structural & molecular biology 2007 imex curation Weisbrich A., Honnappa S., Jaussi R., Okhrimenko O., Frey D., Jelesarov I., Akhmanova A., Steinmetz MO. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Weisbrich A., Honnappa S., Jaussi R., Okhrimenko O., Frey D., Jelesarov I., Akhmanova A., Steinmetz MO. DIP original experiment: DIP-255091X Nature structural & molecular biology 2007 IMEx Structure-function relationship of CAP-Gly domains. Structure-function relationship of CAP-Gly domains. Structure-function relationship of CAP-Gly domains. Nature structural & molecular biology 2007 imex curation Weisbrich A., Honnappa S., Jaussi R., Okhrimenko O., Frey D., Jelesarov I., Akhmanova A., Steinmetz MO. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Weisbrich A., Honnappa S., Jaussi R., Okhrimenko O., Frey D., Jelesarov I., Akhmanova A., Steinmetz MO. DIP original experiment: DIP-255088X Nature structural & molecular biology 2007 IMEx Structure-function relationship of CAP-Gly domains. Structure-function relationship of CAP-Gly domains. Structure-function relationship of CAP-Gly domains. Nature structural & molecular biology 2007 imex curation Weisbrich A., Honnappa S., Jaussi R., Okhrimenko O., Frey D., Jelesarov I., Akhmanova A., Steinmetz MO. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Weisbrich A., Honnappa S., Jaussi R., Okhrimenko O., Frey D., Jelesarov I., Akhmanova A., Steinmetz MO. DIP original experiment: DIP-255089X Nature structural & molecular biology 2007 IMEx Structure-function relationship of CAP-Gly domains. Structure-function relationship of CAP-Gly domains. Structure-function relationship of CAP-Gly domains. Nature structural & molecular biology 2007 imex curation Weisbrich A., Honnappa S., Jaussi R., Okhrimenko O., Frey D., Jelesarov I., Akhmanova A., Steinmetz MO. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Weisbrich A., Honnappa S., Jaussi R., Okhrimenko O., Frey D., Jelesarov I., Akhmanova A., Steinmetz MO. DIP original experiment: DIP-255085X Nature structural & molecular biology 2007 IMEx Structure-function relationship of CAP-Gly domains. Structure-function relationship of CAP-Gly domains. Structure-function relationship of CAP-Gly domains. Nature structural & molecular biology 2007 imex curation Weisbrich A., Honnappa S., Jaussi R., Okhrimenko O., Frey D., Jelesarov I., Akhmanova A., Steinmetz MO. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Weisbrich A., Honnappa S., Jaussi R., Okhrimenko O., Frey D., Jelesarov I., Akhmanova A., Steinmetz MO. DIP original experiment: DIP-255086X Nature structural & molecular biology 2007 IMEx Structure-function relationship of CAP-Gly domains. Structure-function relationship of CAP-Gly domains. Structure-function relationship of CAP-Gly domains. Nature structural & molecular biology 2007 imex curation Weisbrich A., Honnappa S., Jaussi R., Okhrimenko O., Frey D., Jelesarov I., Akhmanova A., Steinmetz MO. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Weisbrich A., Honnappa S., Jaussi R., Okhrimenko O., Frey D., Jelesarov I., Akhmanova A., Steinmetz MO. DIP original experiment: DIP-255092X Nature structural & molecular biology 2007 IMEx Structure-function relationship of CAP-Gly domains. Structure-function relationship of CAP-Gly domains. Structure-function relationship of CAP-Gly domains. Nature structural & molecular biology 2007 imex curation Weisbrich A., Honnappa S., Jaussi R., Okhrimenko O., Frey D., Jelesarov I., Akhmanova A., Steinmetz MO. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Weisbrich A., Honnappa S., Jaussi R., Okhrimenko O., Frey D., Jelesarov I., Akhmanova A., Steinmetz MO. DIP original experiment: DIP-255087X Nature structural & molecular biology 2007 IMEx Structure-function relationship of CAP-Gly domains. dctn1_human Dynactin subunit 1 DCTN1 150 kDa dynein-associated polypeptide DAP-150 p150-glued p135 protein protein human Homo sapiens Human MAQSKRHVYSRTPSGSRMSAEASARPLRVGSRVEVIGKGHRGTVAYVGATLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVFEDGADTTSPETPDSSASKVLKREGTDTTAKTSKLRGLKPKKAPTARKTTTRRPKPTRPASTGVAGASSSLGPSGSASAGELSSSEPSTPAQTPLAAPIIPTPVLTSPGAVPPLPSPSKEEEGLRAQVRDLEEKLETLRLKRAEDKAKLKELEKHKIQLEQVQEWKSKMQEQQADLQRRLKEARKEAKEALEAKERYMEEMADTADAIEMATLDKEMAEERAESLQQEVEALKERVDELTTDLEILKAEIEEKGSDGAASSYQLKQLEEQNARLKDALVRMRDLSSSEKQEHVKLQKLMEKKNQELEVVRQQRERLQEELSQAESTIDELKEQVDAALGAEEMVEMLTDRNLNLEEKVRELRETVGDLEAMNEMNDELQENARETELELREQLDMAGARVREAQKRVEAAQETVADYQQTIKKYRQLTAHLQDVNRELTNQQEASVERQQQPPPETFDFKIKFAETKAHAKAIEMELRQMEVAQANRHMSLLTAFMPDSFLRPGGDHDCVLVLLLMPRLICKAELIRKQAQEKFELSENCSERPGLRGAAGEQLSFAAGLVYSLSLLQATLHRYEHALSQCSVDVYKKVGSLYPEMSAHERSLDFLIELLHKDQLDETVNVEPLTKAIKYYQHLYSIHLAEQPEDCTMQLADHIKFTQSALDCMSVEVGRLRAFLQGGQEATDIALLLRDLETSCSDIRQFCKKIRRRMPGTDAPGIPAALAFGPQVSDTLLDCRKHLTWVVAVLQEVAAAAAQLIAPLAENEGLLVAALEELAFKASEQIYGTPSSSPYECLRQSCNILISTMNKLATAMQEGEYDAERPPSKPPPVELRAAALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKKLDSAAKDADERIEKVQTRLEETQALLRKKEKEFEETMDALQADIDQLEAEKAELKQRLNSQSKRTIEGLRGPPPSGIATLVSGIAGEEQQRGAIPGQAPGSVPGPGLVKDSPLLLQQISAMRLHISQLQHENSILKGAQMKASLASLPPLHVAKLSHEGPGSELPAGALYRKTSQLLETLNQLSTHTHVVDITRTSPAAKSPSAQLMEQVAQLKSLSDTVEKLKDEVLKETVSQRPGATVPTDFATFPSSAFLRAKEEQQDDTVYMGKVTFSCAAGFGQRHRLVLTQEQLHQLHSRLIS DIP protein Q14203 original sequence version: null DIP protein Q14203 original sequence version: 143 DIP protein Q14203 original sequence version: 135 DIP protein Q14203 original sequence version: 140 DIP protein Q14203-1 original sequence version: 146 DIP protein Q14203-1 original sequence version: 112 6DCEA5E67856E4BC p30622-1 CAP-Gly domain-containing linker protein 1 CLIP1 CYLN1 Cytoplasmic linker protein 1 Cytoplasmic linker protein 170 alpha-2 RSN Reed-Sternberg intermediate filament-associated protein Restin Long protein protein human Homo sapiens Human MSMLKPSGLKAPTKILKPGSTALKTPTAVVAPVEKTISSEKASSTPSSETQEEFVDDFRVGERVWVNGNKPGFIQFLGETQFAPGQWAGIVLDEPIGKNDGSVAGVRYFQCEPLKGIFTRPSKLTRKVQAEDEANGLQTTPASRATSPLCTSTASMVSSSPSTPSNIPQKPSQPAAKEPSATPPISNLTKTASESISNLSEAGSIKKGERELKIGDRVLVGGTKAGVVRFLGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCQPKYGLFAPVHKVTKIGFPSTTPAKAKANAVRRVMATTSASLKRSPSASSLSSMSSVASSVSSRPSRTGLLTETSSRYARKISGTTALQEALKEKQQHIEQLLAERDLERAEVAKATSHVGEIEQELALARDGHDQHVLELEAKMDQLRTMVEAADREKVELLNQLEEEKRKVEDLQFRVEEESITKGDLETQTKLEHARIKELEQSLLFEKTKADKLQRELEDTRVATVSEKSRIMELEKDLALRVQEVAELRRRLESNKPAGDVDMSLSLLQEISSLQEKLEVTRTDHQREITSLKEHFGAREETHQKEIKALYTATEKLSKENESLKSKLEHANKENSDVIALWKSKLETAIASHQQAMEELKVSFSKGLGTETAEFAELKTQIEKMRLDYQHEIENLQNQQDSERAAHAKEMEALRAKLMKVIKEKENSLEAIRSKLDKAEDQHLVEMEDTLNKLQEAEIKVKELEVLQAKCNEQTKVIDNFTSQLKATEEKLLDLDALRKASSEGKSEMKKLRQQLEAAEKQIKHLEIEKNAESSKASSITRELQGRELKLTNLQENLSEVSQVKETLEKELQILKEKFAEASEEAVSVQRSMQETVNKLHQKEEQFNMLSSDLEKLRENLADMEAKFREKDEREEQLIKAKEKLENDIAEIMKMSGDNSSQLTKMNDELRLKERDVEELQLKLTKANENASFLQKSIEDMTVKAEQSQQEAAKKHEEEKKELERKLSDLEKKMETSHNQCQELKARYERATSETKTKHEEILQNLQKTLLDTEDKLKGAREENSGLLQELEELRKQADKAKAAQTAEDAMQIMEQMTKEKTETLASLEDTKQTNAKLQNELDTLKENNLKNVEELNKSKELLTVENQKMEEFRKEIETLKQAAAQKSQQLSALQEENVKLAEELGRSRDEVTSHQKLEEERSVLNNQLLEMKKRESKFIKDADEEKASLQKSISITSALLTEKDAELEKLRNEVTVLRGENASAKSLHSVVQTLESDKVKLELKVKNLELQLKENKRQLSSSSGNTDTQADEDERAQESQIDFLNSVIVDLQRKNQDLKMKVEMMSEAALNGNGDDLNNYDSDDQEKQSKKKPRLFCDICDCFDLHDTEDCPTQAQMSEDPPHSTHHGSRGEERPYCEICEMFGHWATNCNDDETF DIP protein P30622-1 original sequence version: 140 DIP protein P30622-1 original sequence version: 151 DIP protein P30622-1 original sequence version: 118 0A4F166DD94254E8 mare1_human Microtubule-associated protein RP/EB family member 1 APC-binding protein EB1 End-binding protein 1 MAPRE1 protein protein human Homo sapiens Human MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKKVKFQAKLEHEYIQNFKILQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYDGKDYDPVAARQGQETAVAPSLVAPALNKPKKPLTSSSAAPQRPISTQRTAAAPKAGPGVVRKNPGVGNGDDEAAELMQQVNVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVLQRIVDILYATDEGFVIPDEGGPQEEQEEY DIP protein Q15691 original sequence version: 154 DIP protein Q15691 original sequence version: 151 DIP protein Q15691 original sequence version: 143 DIP protein Q15691 original sequence version: 84 08C8999F45A145ED clip1-mapre1-4 4 14 unspecified role unspecified role unspecified role unspecified role Region 56-128 Region 56-128 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Region 210-282 Region 210-282 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 15 unspecified role unspecified role unspecified role unspecified role Region 191-268 Region 191-268 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction clip1-clip1-9 11 14 unspecified role unspecified role unspecified role unspecified role Region 1388-1427 Region 1388-1427 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 14 unspecified role unspecified role unspecified role unspecified role Region 56-128 Region 56-128 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli putative self interaction putative self interaction clip1-dctn1-4 9 14 unspecified role unspecified role unspecified role unspecified role Region 1388-1427 Region 1388-1427 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 13 unspecified role unspecified role unspecified role unspecified role Region 18-111 Region 18-111 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction clip1-clip1-10 1 14 unspecified role unspecified role unspecified role unspecified role Region 1388-1427 Region 1388-1427 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 14 unspecified role unspecified role unspecified role unspecified role Region 210-282 Region 210-282 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli putative self interaction putative self interaction dctn1-mapre1-2 7 15 unspecified role unspecified role unspecified role unspecified role Region 191-268 Region 191-268 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 13 unspecified role unspecified role unspecified role unspecified role Region 18-111 Region 18-111 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q14203:p.Asn69Ala N69A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain N A This feature has been corrected as a result of our quality control procedures. The original label was 'N69A'. Wed May 02 16:02:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn69ala' Tue Jun 30 17:44:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn69Ala' Q14203:p.[Lys68Ala;Asn69Ala] K68A/N69A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain N A certain certain sequence position certain certain certain sequence position certain K A This feature has been corrected as a result of our quality control procedures. The original label was 'K68A/N69A'. Wed May 02 16:54:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys68ala,asn69ala' Tue Jun 30 17:20:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys68Ala;Asn69Ala]' ecolx Escherichia coli direct interaction direct interaction clip1-dctn1-5 2 14 unspecified role unspecified role unspecified role unspecified role Region 1388-1427 Region 1388-1427 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 13 unspecified role unspecified role unspecified role unspecified role Region 18-111 Region 18-111 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction clip1-dctn1-6 12 14 unspecified role unspecified role unspecified role unspecified role Region 1388-1427 Region 1388-1427 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 13 unspecified role unspecified role unspecified role unspecified role Region 18-111 Region 18-111 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q14203:p.[Lys68Ala;Asn69Ala] K68A/N69A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain N A certain certain sequence position certain certain certain sequence position certain K A This feature has been corrected as a result of our quality control procedures. The original label was 'K68A/N69A'. Wed May 02 15:10:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys68ala,asn69ala' Tue Jun 30 20:15:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys68Ala;Asn69Ala]' Q14203:p.Lys68Ala K68A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain K A This feature has been corrected as a result of our quality control procedures. The original label was 'K68A'. Wed May 02 15:36:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys68ala' Tue Jun 30 19:03:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys68Ala' Q14203:p.Asn69Ala N69A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain N A This feature has been corrected as a result of our quality control procedures. The original label was 'N69A'. Wed May 02 16:38:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn69ala' Tue Jun 30 18:44:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn69Ala' Q14203:p.Asn69His N69H mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain N H This feature has been corrected as a result of our quality control procedures. The original label was 'N69H'. Wed May 02 18:59:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn69his' Tue Jun 30 20:03:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn69His' Q14203:p.Arg90Pro R90P/S mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain R P Wed May 02 16:07:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg90pro' Tue Jun 30 19:46:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg90Pro' Q14203:p.Gln93Lys Q93K/R mutation increasing strength mutation increasing interaction strength mutation increasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain Q K Wed May 02 17:41:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln93lys' Tue Jun 30 16:23:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln93Lys' Q14203:p.Arg90Ser mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R S Wed May 02 17:07:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg90ser' Tue Jun 30 15:56:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg90Ser' Q14203:p.Gln93Arg mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain Q R Wed May 02 16:59:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln93arg' Tue Jun 30 17:30:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln93Arg' ecolx Escherichia coli direct interaction direct interaction dctn1-mapre1-3 8 15 unspecified role unspecified role unspecified role unspecified role Region 191-268 Region 191-268 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q15691:p.Tyr268Ile Y268I/G mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain Y I Wed May 02 16:41:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr268ile' Tue Jun 30 17:22:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr268Ile' Q15691:p.Tyr268Gly mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Y G Wed May 02 14:41:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr268gly' Tue Jun 30 17:17:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr268Gly' ecolx Escherichia coli 13 unspecified role unspecified role unspecified role unspecified role Region 18-111 Region 18-111 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction clip1-clip1-11 5 14 unspecified role unspecified role unspecified role unspecified role Region 1357-1404 Region 1357-1404 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 14 unspecified role unspecified role unspecified role unspecified role Region 210-282 Region 210-282 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli putative self interaction putative self interaction clip1-dctn1-7 10 14 unspecified role unspecified role unspecified role unspecified role Region 1388-1427 Region 1388-1427 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P30622-1:p.Ile1410His I1410H/D mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain I H Wed May 02 15:54:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile1410his' Tue Jun 30 17:28:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile1410His' P30622-1:p.Ile1410Asp mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain I D Wed May 02 14:48:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile1410asp' Tue Jun 30 18:43:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile1410Asp' ecolx Escherichia coli 13 unspecified role unspecified role unspecified role unspecified role Region 18-111 Region 18-111 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction clip1-dctn1-8 3 14 unspecified role unspecified role unspecified role unspecified role Region 1388-1427 Region 1388-1427 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 13 unspecified role unspecified role unspecified role unspecified role Region 18-111 Region 18-111 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction clip1-clip1-12 6 14 unspecified role unspecified role unspecified role unspecified role Region 1357-1404 Region 1357-1404 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 14 unspecified role unspecified role unspecified role unspecified role Region 56-128 Region 56-128 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli putative self interaction putative self interaction