DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The Atg5 Atg12 conjugate associates with innate antiviral immune responses. The Atg5 Atg12 conjugate associates with innate antiviral immune responses. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Jounai N., Takeshita F., Kobiyama K., Sawano A., Miyawaki A., Xin KQ., Ishii KJ., Kawai T., Akira S., Suzuki K., Okuda K. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Jounai N., Takeshita F., Kobiyama K., Sawano A., Miyawaki A., Xin KQ., Ishii KJ., Kawai T., Akira S., Suzuki K., Okuda K. DIP original experiment: DIP-113903X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx The Atg5 Atg12 conjugate associates with innate antiviral immune responses. The Atg5 Atg12 conjugate associates with innate antiviral immune responses. The Atg5 Atg12 conjugate associates with innate antiviral immune responses. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Jounai N., Takeshita F., Kobiyama K., Sawano A., Miyawaki A., Xin KQ., Ishii KJ., Kawai T., Akira S., Suzuki K., Okuda K. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Jounai N., Takeshita F., Kobiyama K., Sawano A., Miyawaki A., Xin KQ., Ishii KJ., Kawai T., Akira S., Suzuki K., Okuda K. DIP original experiment: DIP-113906X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx The Atg5 Atg12 conjugate associates with innate antiviral immune responses. The Atg5 Atg12 conjugate associates with innate antiviral immune responses. The Atg5 Atg12 conjugate associates with innate antiviral immune responses. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Jounai N., Takeshita F., Kobiyama K., Sawano A., Miyawaki A., Xin KQ., Ishii KJ., Kawai T., Akira S., Suzuki K., Okuda K. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Jounai N., Takeshita F., Kobiyama K., Sawano A., Miyawaki A., Xin KQ., Ishii KJ., Kawai T., Akira S., Suzuki K., Okuda K. DIP original experiment: DIP-113907X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx The Atg5 Atg12 conjugate associates with innate antiviral immune responses. The Atg5 Atg12 conjugate associates with innate antiviral immune responses. The Atg5 Atg12 conjugate associates with innate antiviral immune responses. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Jounai N., Takeshita F., Kobiyama K., Sawano A., Miyawaki A., Xin KQ., Ishii KJ., Kawai T., Akira S., Suzuki K., Okuda K. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Jounai N., Takeshita F., Kobiyama K., Sawano A., Miyawaki A., Xin KQ., Ishii KJ., Kawai T., Akira S., Suzuki K., Okuda K. DIP original experiment: DIP-113910X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx The Atg5 Atg12 conjugate associates with innate antiviral immune responses. The Atg5 Atg12 conjugate associates with innate antiviral immune responses. The Atg5 Atg12 conjugate associates with innate antiviral immune responses. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Jounai N., Takeshita F., Kobiyama K., Sawano A., Miyawaki A., Xin KQ., Ishii KJ., Kawai T., Akira S., Suzuki K., Okuda K. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Jounai N., Takeshita F., Kobiyama K., Sawano A., Miyawaki A., Xin KQ., Ishii KJ., Kawai T., Akira S., Suzuki K., Okuda K. DIP original experiment: DIP-113904X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx The Atg5 Atg12 conjugate associates with innate antiviral immune responses. The Atg5 Atg12 conjugate associates with innate antiviral immune responses. The Atg5 Atg12 conjugate associates with innate antiviral immune responses. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Jounai N., Takeshita F., Kobiyama K., Sawano A., Miyawaki A., Xin KQ., Ishii KJ., Kawai T., Akira S., Suzuki K., Okuda K. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Jounai N., Takeshita F., Kobiyama K., Sawano A., Miyawaki A., Xin KQ., Ishii KJ., Kawai T., Akira S., Suzuki K., Okuda K. DIP original experiment: DIP-113912X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx The Atg5 Atg12 conjugate associates with innate antiviral immune responses. The Atg5 Atg12 conjugate associates with innate antiviral immune responses. The Atg5 Atg12 conjugate associates with innate antiviral immune responses. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Jounai N., Takeshita F., Kobiyama K., Sawano A., Miyawaki A., Xin KQ., Ishii KJ., Kawai T., Akira S., Suzuki K., Okuda K. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Jounai N., Takeshita F., Kobiyama K., Sawano A., Miyawaki A., Xin KQ., Ishii KJ., Kawai T., Akira S., Suzuki K., Okuda K. DIP original experiment: DIP-113911X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx The Atg5 Atg12 conjugate associates with innate antiviral immune responses. The Atg5 Atg12 conjugate associates with innate antiviral immune responses. The Atg5 Atg12 conjugate associates with innate antiviral immune responses. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Jounai N., Takeshita F., Kobiyama K., Sawano A., Miyawaki A., Xin KQ., Ishii KJ., Kawai T., Akira S., Suzuki K., Okuda K. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Jounai N., Takeshita F., Kobiyama K., Sawano A., Miyawaki A., Xin KQ., Ishii KJ., Kawai T., Akira S., Suzuki K., Okuda K. DIP original experiment: DIP-113905X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx The Atg5 Atg12 conjugate associates with innate antiviral immune responses. The Atg5 Atg12 conjugate associates with innate antiviral immune responses. The Atg5 Atg12 conjugate associates with innate antiviral immune responses. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Jounai N., Takeshita F., Kobiyama K., Sawano A., Miyawaki A., Xin KQ., Ishii KJ., Kawai T., Akira S., Suzuki K., Okuda K. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Jounai N., Takeshita F., Kobiyama K., Sawano A., Miyawaki A., Xin KQ., Ishii KJ., Kawai T., Akira S., Suzuki K., Okuda K. DIP original experiment: DIP-113909X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx The Atg5 Atg12 conjugate associates with innate antiviral immune responses. The Atg5 Atg12 conjugate associates with innate antiviral immune responses. The Atg5 Atg12 conjugate associates with innate antiviral immune responses. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Jounai N., Takeshita F., Kobiyama K., Sawano A., Miyawaki A., Xin KQ., Ishii KJ., Kawai T., Akira S., Suzuki K., Okuda K. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Jounai N., Takeshita F., Kobiyama K., Sawano A., Miyawaki A., Xin KQ., Ishii KJ., Kawai T., Akira S., Suzuki K., Okuda K. DIP original experiment: DIP-113908X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx The Atg5 Atg12 conjugate associates with innate antiviral immune responses. ifih1_human Interferon-induced helicase C domain-containing protein 1 Helicase with 2 CARD domains Interferon-induced with helicase C domain protein 1 Melanoma differentiation-associated protein 5 Murabutide down-regulated protein RNA helicase-DEAD box protein 116 RIG-I-like receptor 2 IFIH1 MDA5 RH116 Clinically amyopathic dermatomyositis autoantigen 140 kDa protein protein human Homo sapiens Human MSNGYSTDENFRYLISCFRARVKMYIQVEPVLDYLTFLPAEVKEQIQRTVATSGNMQAVELLLSTLEKGVWHLGWTREFVEALRRTGSPLAARYMNPELTDLPSPSFENAHDEYLQLLNLLQPTLVDKLLVRDVLDKCMEEELLTIEDRNRIAAAENNGNESGVRELLKRIVQKENWFSAFLNVLRQTGNNELVQELTGSDCSESNAEIENLSQVDGPQVEEQLLSTTVQPNLEKEVWGMENNSSESSFADSSVVSESDTSLAEGSVSCLDESLGHNSNMGSDSGTMGSDSDEENVAARASPEPELQLRPYQMEVAQPALEGKNIIICLPTGSGKTRVAVYIAKDHLDKKKKASEPGKVIVLVNKVLLVEQLFRKEFQPFLKKWYRVIGLSGDTQLKISFPEVVKSCDIIISTAQILENSLLNLENGEDAGVQLSDFSLIIIDECHHTNKEAVYNNIMRHYLMQKLKNNRLKKENKPVIPLPQILGLTASPGVGGATKQAKAEEHILKLCANLDAFTIKTVKENLDQLKNQIQEPCKKFAIADATREDPFKEKLLEIMTRIQTYCQMSPMSDFGTQPYEQWAIQMEKKAAKEGNRKERVCAEHLRKYNEALQINDTIRMIDAYTHLETFYNEEKDKKFAVIEDDSDEGGDDEYCDGDEDEDDLKKPLKLDETDRFLMTLFFENNKMLKRLAENPEYENEKLTKLRNTIMEQYTRTEESARGIIFTKTRQSAYALSQWITENEKFAEVGVKAHHLIGAGHSSEFKPMTQNEQKEVISKFRTGKINLLIATTVAEEGLDIKECNIVIRYGLVTNEIAMVQARGRARADESTYVLVAHSGSGVIEHETVNDFREKMMYKAIHCVQNMKPEEYAHKILELQMQSIMEKKMKTKRNIAKHYKNNPSLITFLCKNCSVLACSGEDIHVIEKMHHVNMTPEFKELYIVRENKALQKKCADYQINGEIICKCGQAWGTMMVHKGLDLPCLKIRNFVVVFKNNSTKKQYKKWVELPITFPNLDYSECCLFSDED DIP protein Q9BYX4 original sequence version: 130 DIP protein Q9BYX4 original sequence version: 120 DIP protein Q9BYX4 original sequence version: 123 DIP protein Q9BYX4 original sequence version: 66 DIP protein Q9BYX4 original sequence version: 82 DIP protein Q9BYX4-1 original sequence version: 136 DIP protein Q9BYX4-1 original sequence version: 107 DIP protein Q9BYX4 original sequence version: 122 789CFB4824B92DC9 atg5_human Autophagy protein 5 APG5-like Apoptosis-specific protein ATG5 APG5L ASP protein protein human Homo sapiens Human MTDDKDVLRDVWFGRIPTCFTLYQDEITEREAEPYYLLLPRVSYLTLVTDKVKKHFQKVMRQEDISEIWFEYEGTPLKWHYPIGLLFDLLASSSALPWNITVHFKSFPEKDLLHCPSKDAIEAHFMSCMKEADALKHKSQVINEMQKKDHKQLWMGLQNDRFDQFWAINRKLMEYPAEENGFRYIPFRIYQTTTERPFIQKLFRPVAADGQLHTLGDLLKEVCPSAIDPEDGEKKNQVMIHGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTD DIP protein Q9H1Y0 original sequence version: 63 DIP protein Q9H1Y0 original sequence version: 56 DIP protein Q9H1Y0-1 original sequence version: 105 DIP protein Q9H1Y0 original sequence version: 105 C33A1E0B3C1DBE5C atg12_human Ubiquitin-like protein ATG12 Autophagy-related protein 12 ATG12 APG12 APG12L protein protein human Homo sapiens Human MAEEPQSVLQLPTSIAAGGEGLTDVSPETTTPEPPSSAAVSPGTEEPAGDTKKKIDILLKAVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAWG DIP protein O94817 original sequence version: 63 DIP protein O94817-1 original sequence version: 102 109258521C2D194F q7z434-1 Mitochondrial antiviral-signaling protein MAVS IPS1 KIAA1271 VISA CARD adapter inducing interferon beta Interferon beta promoter stimulator protein 1 Putative NF-kappa-B-activating protein 031N Virus-induced-signaling adapter protein protein human Homo sapiens Human MPFAEDKTYKYICRNFSNFCNVDVVEILPYLPCLTARDQDRLRATCTLSGNRDTLWHLFNTLQRRPGWVEYFIAALRGCELVDLADEVASVYQSYQPRTSDRPPDPLEPPSLPAERPGPPTPAAAHSIPYNSCREKEPSYPMPVQETQAPESPGENSEQALQTLSPRAIPRNPDGGPLESSSDLAALSPLTSSGHQEQDTELGSTHTAGATSSLTPSRGPVSPSVSFQPLARSTPRASRLPGPTGSVVSTGTSFSSSSPGLASAGAAEGKQGAESDQAEPIICSSGAEAPANSLPSKVPTTLMPVNTVALKVPANPASVSTVPSKLPTSSKPPGAVPSNALTNPAPSKLPINSTRAGMVPSKVPTSMVLTKVSASTVPTDGSSRNEETPAAPTPAGATGGSSAWLDSSSENRGLGSELSKPGVLASQVDSPFSGCFEDLAISASTSLGMGPCHGPEENEYKSEGTFGIHVAENPSIQLLEGNPGPPADPDGGPRPQADRKFQEREVPCHRPSPGALWLQVAVTGVLVVTLLVVLYRRRLH DIP protein Q7Z434-1 original sequence version: 117 DIP protein Q7Z434 original sequence version: 109 DIP protein Q7Z434 original sequence version: 112 DIP protein Q7Z434 original sequence version: 52 DIP protein Q7Z434 original sequence version: 107 DIP protein Q7Z434-1 original sequence version: 107 DIP protein Q7Z434 original sequence version: 95 DIP protein Q7Z434 original sequence version: 69 DIP protein Q7Z434 original sequence version: 72 DIP protein Q7Z434-1 original sequence version: 72 DIP protein Q7Z434 original sequence version: 92 DIP protein Q7Z434 original sequence version: 129 DIP protein Q7Z434 original sequence version: 111 o95786-1 Antiviral innate immune response receptor RIG-I Probable ATP-dependent RNA helicase DDX58 DDX58 DEAD box protein 58 RIG-I-like receptor 1 Retinoic acid-inducible gene 1 protein Retinoic acid-inducible gene I protein protein protein human Homo sapiens Human MTTEQRRSLQAFQDYIRKTLDPTYILSYMAPWFREEEVQYIQAEKNNKGPMEAATLFLKFLLELQEEGWFRGFLDALDHAGYSGLYEAIESWDFKKIEKLEEYRLLLKRLQPEFKTRIIPTDIISDLSECLINQECEEILQICSTKGMMAGAEKLVECLLRSDKENWPKTLKLALEKERNKFSELWIVEKGIKDVETEDLEDKMETSDIQIFYQEDPECQNLSENSCPPSEVSDTNLYSPFKPRNYQLELALPAMKGKNTIICAPTGCGKTFVSLLICEHHLKKFPQGQKGKVVFFANQIPVYEQQKSVFSKYFERHGYRVTGISGATAENVPVEQIVENNDIIILTPQILVNNLKKGTIPSLSIFTLMIFDECHNTSKQHPYNMIMFNYLDQKLGGSSGPLPQVIGLTASVGVGDAKNTDEALDYICKLCASLDASVIATVKHNLEELEQVVYKPQKFFRKVESRISDKFKYIIAQLMRDTESLAKRICKDLENLSQIQNREFGTQKYEQWIVTVQKACMVFQMPDKDEESRICKALFLYTSHLRKYNDALIISEHARMKDALDYLKDFFSNVRAAGFDEIEQDLTQRFEEKLQELESVSRDPSNENPKLEDLCFILQEEYHLNPETITILFVKTRALVDALKNWIEGNPKLSFLKPGILTGRGKTNQNTGMTLPAQKCILDAFKASGDHNILIATSVADEGIDIAQCNLVILYEYVGNVIKMIQTRGRGRARGSKCFLLTSNAGVIEKEQINMYKEKMMNDSILRLQTWDEAVFREKILHIQTHEKFIRDSQEKPKPVPDKENKKLLCRKCKALACYTADVRVIEECHYTVLGDAFKECFVSRPHPKPKQFSSFEKRAKIFCARQNCSHDWGIHVKYKTFEIPVIKIESFVVEDIATGVQTLYSKWKDFHFEKIPFDPAEMSK DIP protein O95786-1 original sequence version: 126 DIP protein O95786-1 original sequence version: 118 DIP protein O95786 original sequence version: 63 DIP protein O95786 original sequence version: 116 DIP protein O95786-1 original sequence version: 116 DIP protein O95786 original sequence version: 105 DIP protein O95786 original sequence version: 80 DIP protein O95786-1 original sequence version: 78 DIP protein O95786 original sequence version: 102 DIP protein O95786-1 original sequence version: 131 DIP protein O95786 original sequence version: 134 DIP protein O95786 original sequence version: 135 DIP protein O95786-1 original sequence version: 120 DIP protein O95786 original sequence version: 120 ddx58-atg5-1 9 15 unspecified role unspecified role bait bait Binding region 1-604 Binding region 1-604 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 12 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association atg5-mavs-1 7 14 unspecified role unspecified role prey prey Binding region 1-100 Binding region 1-100 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range in vitro In vitro 12 unspecified role unspecified role bait bait GST-tag GST-tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction ddx58-atg12-1 1 13 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 15 unspecified role unspecified role bait bait Binding region 1-604 Binding region 1-604 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 12 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human association association ifih1-atg12-1 8 11 unspecified role unspecified role bait bait Binding region 1-575 Binding region 1-575 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 13 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 12 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human association association ddx58-mavs-9 10 14 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 15 unspecified role unspecified role bait bait Binding region 1-604 Binding region 1-604 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association mavs-atg5-1 4 14 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 12 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association atg5-ddx58-1 6 15 unspecified role unspecified role prey prey Binding region 1-172 Binding region 1-172 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range in vitro In vitro 12 unspecified role unspecified role bait bait GST-tag GST-tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction atg5-mavs-2 5 12 unspecified role unspecified role bait bait human Homo sapiens Human 14 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association mavs-atg12-1 2 14 unspecified role unspecified role bait bait Binding region 1-100 Binding region 1-100 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Q7Z434-1:p.Thr54Ala T54A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T A This feature has been corrected as a result of our quality control procedures. The original label was 'T54A'. Wed May 02 17:59:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr54ala' Tue Jun 30 20:02:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr54Ala' Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 13 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 12 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human association association ddx58-atg12-2 3 14 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 13 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 15 unspecified role unspecified role bait bait Binding region 1-604 Binding region 1-604 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 12 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human association association