DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural insights into the interaction of the evolutionarily conserved ZPR1 domain tandem with eukaryotic EF1A, receptors, and SMN complexes. Structural insights into the interaction of the evolutionarily conserved ZPR1 domain tandem with eukaryotic EF1A, receptors, and SMN complexes. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Mishra AK., Gangwani L., Davis RJ., Lambright DG. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Mishra AK., Gangwani L., Davis RJ., Lambright DG. DIP original experiment: DIP-113902X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structural insights into the interaction of the evolutionarily conserved ZPR1 domain tandem with eukaryotic EF1A, receptors, and SMN complexes. Structural insights into the interaction of the evolutionarily conserved ZPR1 domain tandem with eukaryotic EF1A, receptors, and SMN complexes. Structural insights into the interaction of the evolutionarily conserved ZPR1 domain tandem with eukaryotic EF1A, receptors, and SMN complexes. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Mishra AK., Gangwani L., Davis RJ., Lambright DG. Only protein-protein interactions in vitro In vitro fluorescence spectr classical fluorescence spectroscopy fluorescence spectr predetermined predetermined participant predetermined Mishra AK., Gangwani L., Davis RJ., Lambright DG. DIP original experiment: DIP-113900X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structural insights into the interaction of the evolutionarily conserved ZPR1 domain tandem with eukaryotic EF1A, receptors, and SMN complexes. Structural insights into the interaction of the evolutionarily conserved ZPR1 domain tandem with eukaryotic EF1A, receptors, and SMN complexes. Structural insights into the interaction of the evolutionarily conserved ZPR1 domain tandem with eukaryotic EF1A, receptors, and SMN complexes. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Mishra AK., Gangwani L., Davis RJ., Lambright DG. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Mishra AK., Gangwani L., Davis RJ., Lambright DG. DIP original experiment: DIP-113901X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structural insights into the interaction of the evolutionarily conserved ZPR1 domain tandem with eukaryotic EF1A, receptors, and SMN complexes. ef1a_yeast Elongation factor 1-alpha TEF1 YPR080W P9513.7 TEF2 YBR118W YBR0913 Translation elongation factor 1A Eukaryotic elongation factor 1A protein protein yeast Saccharomyces cerevisiae Baker's yeast MGKEKSHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYQVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGVGEFEAGISKDGQTREHALLAFTLGVRQLIVAVNKMDSVKWDESRFQEIVKETSNFIKKVGYNPKTVPFVPISGWNGDNMIEATTNAPWYKGWEKETKAGVVKGKTLLEAIDAIEQPSRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFAPAGVTTEVKSVEMHHEQLEQGVPGDNVGFNVKNVSVKEIRRGNVCGDAKNDPPKGCASFNATVIVLNHPGQISAGYSPVLDCHTAHIACRFDELLEKNDRRSGKKLEDHPKFLKSGDAALVKFVPSKPMCVEAFSEYPPLGRFAVRDMRQTVAVGVIKSVDKTEKAAKVTKAAQKAAKK 411C66D830716576 411C66D830716576 zpr1_mouse Zinc finger protein ZPR1 Zfp259 Zinc finger protein 259 Znf259 Zpr1 protein protein mouse Mus musculus Mouse MSASGAVQPGHPGAAVGPSPAAAASPATGPLFRPLSAEDEEQQPTEIESLCMNCYRNGTTRLLLTKIPFFREIIVSSFSCEHCGWNNTEIQSAGRIQDQGVRYTLTVRSQEDMNREVVKTDSATTRIPELDFEIPAFSQKGALTTVEGLISRAISGLEQDQPTRRAVEGAIAERIDEFIGKLKDLKQMASPFTLVIDDPSGNSFVENPHAPQKDNALVITYYDRTPQQAEMLGLQAEAPEEKAEEEDLRNEVLQFNTNCPECNAPAQTNMKLVQIPHFKEVIIMATNCENCGHRTNEVKSGGAVEPLGTRITLHITDPSDMTRDLLKSETCSVEIPELEFELGMAVLGGKFTTLEGLLKDIRELVTKNPFTLGDSSNPDQSEKLQEFSQKLGQIIEGKMKAHFIMNDPAGNSYLQNVYAPEDDPEMKVERYKRTFDQNEELGLNDMKTEGYEAGLAPQR DIP protein Q62384 original sequence version: 60 771D38C7B806044F ef1b_yeast Elongation factor 1-beta EFB1 TEF5 Translation elongation factor 1B alpha Eukaryotic elongation factor 1Balpha YAL003W protein protein yeast Saccharomyces cerevisiae Baker's yeast MASTDFSKIETLKQLNASLADKSYIEGTAVSQADVTVFKAFQSAYPEFSRWFNHIASKADEFDSFPAASAAAAEEEEDDDVDLFGSDDEEADAEAEKLKAERIAAYNAKKAAKPAKPAAKSIVTLDVKPWDDETNLEEMVANVKAIEMEGLTWGAHQFIPIGFGIKKLQINCVVEDDKVSLDDLQQSIEEDEDHVQSTDIAAMQKL BEA764852CE125F7 BEA764852CE125F7 eef1a-zpr1-1 2 5 unspecified role unspecified role unspecified role unspecified role Region 1-240 Region 1-240 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 4 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction ef_1_beta-eef1a-1 1 6 unspecified role unspecified role bait bait Region 116-206 Region 116-206 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 4 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction zpr1-eef1a-1 3 5 unspecified role unspecified role bait bait Region 1-240 Region 1-240 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 4 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction