DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Functions of OsBZR1 and 14-3-3 proteins in brassinosteroid signaling in rice. Functions of OsBZR1 and 14-3-3 proteins in brassinosteroid signaling in rice. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Bai MY., Zhang LY., Gampala SS., Zhu SW., Song WY., Chong K., Wang ZY. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Bai MY., Zhang LY., Gampala SS., Zhu SW., Song WY., Chong K., Wang ZY. DIP original experiment: DIP-113959X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Functions of OsBZR1 and 14-3-3 proteins in brassinosteroid signaling in rice. Functions of OsBZR1 and 14-3-3 proteins in brassinosteroid signaling in rice. Functions of OsBZR1 and 14-3-3 proteins in brassinosteroid signaling in rice. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Bai MY., Zhang LY., Gampala SS., Zhu SW., Song WY., Chong K., Wang ZY. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Bai MY., Zhang LY., Gampala SS., Zhu SW., Song WY., Chong K., Wang ZY. DIP original experiment: DIP-113950X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Functions of OsBZR1 and 14-3-3 proteins in brassinosteroid signaling in rice. Functions of OsBZR1 and 14-3-3 proteins in brassinosteroid signaling in rice. Functions of OsBZR1 and 14-3-3 proteins in brassinosteroid signaling in rice. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Bai MY., Zhang LY., Gampala SS., Zhu SW., Song WY., Chong K., Wang ZY. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Bai MY., Zhang LY., Gampala SS., Zhu SW., Song WY., Chong K., Wang ZY. DIP original experiment: DIP-113952X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Functions of OsBZR1 and 14-3-3 proteins in brassinosteroid signaling in rice. Functions of OsBZR1 and 14-3-3 proteins in brassinosteroid signaling in rice. Functions of OsBZR1 and 14-3-3 proteins in brassinosteroid signaling in rice. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Bai MY., Zhang LY., Gampala SS., Zhu SW., Song WY., Chong K., Wang ZY. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Bai MY., Zhang LY., Gampala SS., Zhu SW., Song WY., Chong K., Wang ZY. DIP original experiment: DIP-113957X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Functions of OsBZR1 and 14-3-3 proteins in brassinosteroid signaling in rice. Functions of OsBZR1 and 14-3-3 proteins in brassinosteroid signaling in rice. Functions of OsBZR1 and 14-3-3 proteins in brassinosteroid signaling in rice. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Bai MY., Zhang LY., Gampala SS., Zhu SW., Song WY., Chong K., Wang ZY. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Bai MY., Zhang LY., Gampala SS., Zhu SW., Song WY., Chong K., Wang ZY. DIP original experiment: DIP-113956X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Functions of OsBZR1 and 14-3-3 proteins in brassinosteroid signaling in rice. Functions of OsBZR1 and 14-3-3 proteins in brassinosteroid signaling in rice. Functions of OsBZR1 and 14-3-3 proteins in brassinosteroid signaling in rice. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Bai MY., Zhang LY., Gampala SS., Zhu SW., Song WY., Chong K., Wang ZY. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Bai MY., Zhang LY., Gampala SS., Zhu SW., Song WY., Chong K., Wang ZY. DIP original experiment: DIP-113954X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Functions of OsBZR1 and 14-3-3 proteins in brassinosteroid signaling in rice. Functions of OsBZR1 and 14-3-3 proteins in brassinosteroid signaling in rice. Functions of OsBZR1 and 14-3-3 proteins in brassinosteroid signaling in rice. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Bai MY., Zhang LY., Gampala SS., Zhu SW., Song WY., Chong K., Wang ZY. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Bai MY., Zhang LY., Gampala SS., Zhu SW., Song WY., Chong K., Wang ZY. DIP original experiment: DIP-113955X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Functions of OsBZR1 and 14-3-3 proteins in brassinosteroid signaling in rice. Functions of OsBZR1 and 14-3-3 proteins in brassinosteroid signaling in rice. Functions of OsBZR1 and 14-3-3 proteins in brassinosteroid signaling in rice. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Bai MY., Zhang LY., Gampala SS., Zhu SW., Song WY., Chong K., Wang ZY. Only protein-protein interactions nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Bai MY., Zhang LY., Gampala SS., Zhu SW., Song WY., Chong K., Wang ZY. DIP original experiment: DIP-113951X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Functions of OsBZR1 and 14-3-3 proteins in brassinosteroid signaling in rice. Functions of OsBZR1 and 14-3-3 proteins in brassinosteroid signaling in rice. Functions of OsBZR1 and 14-3-3 proteins in brassinosteroid signaling in rice. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Bai MY., Zhang LY., Gampala SS., Zhu SW., Song WY., Chong K., Wang ZY. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Bai MY., Zhang LY., Gampala SS., Zhu SW., Song WY., Chong K., Wang ZY. DIP original experiment: DIP-113958X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Functions of OsBZR1 and 14-3-3 proteins in brassinosteroid signaling in rice. Functions of OsBZR1 and 14-3-3 proteins in brassinosteroid signaling in rice. Functions of OsBZR1 and 14-3-3 proteins in brassinosteroid signaling in rice. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Bai MY., Zhang LY., Gampala SS., Zhu SW., Song WY., Chong K., Wang ZY. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Bai MY., Zhang LY., Gampala SS., Zhu SW., Song WY., Chong K., Wang ZY. DIP original experiment: DIP-113953X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Functions of OsBZR1 and 14-3-3 proteins in brassinosteroid signaling in rice. 14337_orysj 14-3-3-like protein GF14-G GF14G G-box factor 14-3-3 homolog G OSJNBa0016I09.32 LOC_Os01g11110 Os01g0209200 protein protein orysj Oryza sativa subsp. japonica (Rice) Rice MAPSDDLVYMAKLAEQAERYDEMVEAMNSVAKLDEGLTKEERNLLSVGYKNLIGAKRAAMRIIGSIELKEETKGKESHVRQTAEYRRKVEAEMDKICCDVINIIDKYLIPHSSGAESSVFYYKMKGDYYRYLAEFKTGTEKIEVSELSLNAYETASKTAQTDLTPTDPIRLGLALNISVFYCEIMNSPDKACQLAKNAFDEAVAELPSLSEENYKDSTLIMQLLRDNLALWNSDMADDADDIRERTDTTGAKGDPAA DIP protein Q5QNB8 original sequence version: 19 14332_orysj 14-3-3-like protein GF14-B GF14B G-box factor 14-3-3 homolog B B0812A04.1 B1358B12.12 OSJNBa0072F16.20 Os04g0462500 LOC_Os04g38870 protein protein orysj Oryza sativa subsp. japonica (Rice) Rice MSAQAELSREENVYMAKLAEQAERYEEMVEFMEKVAKTVDSEELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEESRGNEDRVTLIKDYRGKIETELTKICDGILKLLESHLVPSSTAPESKVFYLKMKGDYYRYLAEFKTGAERKDAAENTMVAYKAAQDIALAELPPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAISELDTLSEESYKDSTLIMQLLRDNLTLWTSDISEDTAEEIREAPKRDSSEGQ DIP protein Q7XTE8 original sequence version: 31 739F14BA1BB5E0EA 14333_orysj 14-3-3-like protein GF14-C GF14C G-box factor 14-3-3 homolog C OJ1124_B05.7 Os08g0430500 LOC_Os08g33370 protein protein orysj Oryza sativa subsp. japonica (Rice) Rice MSREENVYMAKLAEQAERYEEMVEYMEKVAKTVDVEELTVEERNLLSVAYKNVIGARRASWRIVSSIEQKEEGRGNEEHVTLIKEYRGKIEAELSKICDGILKLLDSHLVPSSTAAESKVFYLKMKGDYHRYLAEFKTGAERKEAAESTMVAYKAAQDIALADLAPTHPIRLGLALNFSVFYYEILNSPDKACNLAKQAFDEAISELDTLGEESYKDSTLIMQLLRDNLTLWTSDLTEDGGDEVKEASKGDACEGQ DIP protein Q6ZKC0 original sequence version: 27 E8B1D9A3ECB4C70D 14335_orysj 14-3-3-like protein GF14-E G-box factor 14-3-3 homolog E GF14E B1267B06.30-1 OJ1115_A05.5-1 OsJ_07268 LOC_Os02g36974 Os02g0580300 protein protein orysj Oryza sativa subsp. japonica (Rice) Rice MSQPAELSREENVYMAKLAEQAERYEEMVEFMEKVAKTVDSEELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEESRGNEDRCTLIKEYRGKIETELSKICDGILKLLDSHLVPSSTAPESKVFYLKMKGDYYRYLAEFKTGAERKDAAENTMVAYKAAQDIALAELPPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAISELDTLSEESYKDSTLIMQLLRDNLTLWTSDISEDAAEEIKEAPKGESGDGQ DIP protein Q6EUP4 original sequence version: 25 2026F19B5414CF2A bzr1_orysj Protein BZR1 homolog 1 BZR1 Protein BRASSINAZOLE-RESISTANT 1 homolog 1 OsJ_24880 P0453G03.22 LOC_Os07g39220 Os07g0580500 protein protein orysj Oryza sativa subsp. japonica (Rice) Rice MTSGAAAAGRTPTWKERENNKRRERRRRAIAAKIFTGLRALGNYNLPKHCDNNEVLKALCREAGWVVEDDGTTYRKGCKPPPSSAGGASVGMSPCSSTQLLSAPSSSFPSPVPSYHASPASSSFPSPSRIDNPSASCLLPFLRGLPNLPPLRVSSSAPVTPPLSSPTASRPPKIRKPDWDVDPFRHPFFAVSAPASPTRGRRLEHPDTIPECDESDVSTVDSGRWISFQMATTAPTSPTYNLVNPGASTSNSMEIEGTAGRGGAEFEFDKGRVTPWEGERIHEVAAEELELTLGVGAK DIP protein Q7XI96 original sequence version: 23 14334_orysj 14-3-3-like protein GF14-D GF14D G-box factor 14-3-3 homolog D OsJ_34200 LOC_Os11g34450 Os11g0546900 protein protein orysj Oryza sativa subsp. japonica (Rice) Rice MSPAEPTREESVYKAKLAEQAERYEEMVEYMERVARAAGGASGGEELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEEGRGNDAHAATIRSYRGKIEAELARICDGILALLDSHLVPSAGAAESKVFYLKMKGDYHRYLAEFKSGDERKQAAESTMNAYKAAQDIALADLAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAISELDSLGEESYKDSTLIMQLLRDNLTLWTSDANDDGGDEIKEAAAPKEPGDQ DIP protein Q2R2W2 original sequence version: 21 14336_orysj 14-3-3-like protein GF14-F G-box factor 14-3-3 homolog F OsGF14a 14-3-3-like protein S94 Stress-regulated 14-3-3 protein GF14F OsJ_12311 LOC_Os03g50290 Os03g0710800 protein protein orysj Oryza sativa subsp. japonica (Rice) Rice MSPAEASREENVYMAKLAEQAERYEEMVEFMEKVAKTTDVGELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEESRGNEAYVASIKEYRSRIETELSKICDGILKLLDSHLVPSATAAESKVFYLKMKGDYHRYLAEFKSGAERKEAAENTLVAYKSAQDIALADLPTTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDDAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDNAEDGGDEIKEAAKPEGEGH DIP protein Q06967 original sequence version: 49 483507B10661DF95 14338_orysj Putative 14-3-3-like protein GF14-H GF14H G-box factor 14-3-3 homolog H LOC_Os11g39540 Os11g0609600 protein protein orysj Oryza sativa subsp. japonica (Rice) Rice MKEREKVVRLAKLAEQAERYDDMVEFMKTLARMDVDMSAEERLLFSVGFKKTIGARRASWRILESLEQKVTAGDQPGVTINGYKKKVEDELRAVCNEVLSIIAIHCLPLANSGENVVFFYKMKGDYYRYLAEFSTGTEKKAATDQSLMAYQAWPCAQLFSLLEIMNSPERASQVAKQALDEATAEINSAGVEGYKDSMLMMQLLKENLALWTSELTGGETSKDDDVVMEG DIP protein Q2R1D5 original sequence version: 17 14331_orysj 14-3-3-like protein GF14-A G-box factor 14-3-3 homolog A GF14A OJ1113_A10.40 OSJNBb0092C08.10 Os08g0480800 LOC_Os08g37490 protein protein orysj Oryza sativa subsp. japonica (Rice) Rice MAAAAGGGTREEMVYMAKLAEQAERYEEMVEFMEKVVTAAAAGGGGELTVEERNLLSVAYKNVIGARRASWRIVSSIEQKEEGRGAAGHAAAARSYRARVEAELSNICAGILRLLDERLVPAAAAVDAKVFYLKMKGDYHRYLAEFKTGAERKDAADATLAAYQAAQDIAMKELSPTHPIRLGLALNFSVFYYEILNSPDRACTLAKQAFDEAISELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGGDEMRDATKPEDEH DIP protein Q84J55 original sequence version: 29 F4094830FEF61600 bzr1-gf14e-1 7 14 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 15 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction bzr1-gf14a-1 2 19 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 15 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction bzr1-gf14b-1 3 12 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 15 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction bzr1-gf14c-1 8 13 unspecified role unspecified role unspecified role unspecified role C-terminal of CFP C-terminal of CFP cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range nicbe Nicotiana benthamiana 15 unspecified role unspecified role unspecified role unspecified role Q7XI96:p.Ser156Gly S156G mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S G This feature has been corrected as a result of our quality control procedures. The original label was 'S156G'. Wed May 02 14:40:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser156gly' Tue Jun 30 16:17:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser156Gly' N-terminal of YFP N-terminal of YFP yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range nicbe Nicotiana benthamiana direct interaction direct interaction bzr1-gf14c-2 10 13 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 15 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction bzr1-gf14h-1 9 18 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 15 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction bzr1-gf14c-3 1 13 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 15 unspecified role unspecified role bait bait Q7XI96:p.Ser156Gly S156G mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S G This feature has been corrected as a result of our quality control procedures. The original label was 'S156G'. Wed May 02 17:32:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser156gly' Tue Jun 30 16:50:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser156Gly' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction bzr1-gf14f-1 5 17 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 15 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction bzr1-gf14g-1 4 11 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 15 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction bzr1-gf14d-1 6 16 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 15 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction