DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The structural basis for unidirectional rotation of thermoalkaliphilic F1-ATPase. The structural basis for unidirectional rotation of thermoalkaliphilic F1-ATPase. Structure (London, England : 1993) 2007 imex curation Stocker A., Keis S., Vonck J., Cook GM., Dimroth P. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Stocker A., Keis S., Vonck J., Cook GM., Dimroth P. DIP original experiment: DIP-67820X Structure (London, England : 1993) 2007 IMEx The structural basis for unidirectional rotation of thermoalkaliphilic F1-ATPase. The structural basis for unidirectional rotation of thermoalkaliphilic F1-ATPase. The structural basis for unidirectional rotation of thermoalkaliphilic F1-ATPase. Structure (London, England : 1993) 2007 imex curation Stocker A., Keis S., Vonck J., Cook GM., Dimroth P. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Stocker A., Keis S., Vonck J., Cook GM., Dimroth P. DIP original experiment: DIP-67822X Structure (London, England : 1993) 2007 IMEx The structural basis for unidirectional rotation of thermoalkaliphilic F1-ATPase. The structural basis for unidirectional rotation of thermoalkaliphilic F1-ATPase. The structural basis for unidirectional rotation of thermoalkaliphilic F1-ATPase. Structure (London, England : 1993) 2007 imex curation Stocker A., Keis S., Vonck J., Cook GM., Dimroth P. Only protein-protein interactions ecolx Escherichia coli 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Stocker A., Keis S., Vonck J., Cook GM., Dimroth P. DIP original experiment: DIP-67821X Structure (London, England : 1993) 2007 IMEx The structural basis for unidirectional rotation of thermoalkaliphilic F1-ATPase. q71cg4_9baci ATP synthase gamma chain atpG ATP synthase F1 sector gamma subunit F-ATPase gamma subunit protein protein bacillus sp. ta2.a1 Bacillus sp. TA2.A1 MQGMREIKRRIRSVKNTRQITKAMKMVAAAKLRRAQETAENARPYADKIKEVISSIAAGTKDFSHPMLEARPVKKTGYMVITSDRGLAGPYNANILRLVSKTIEERHQSKDEYVIFAVGRKGRDFFKKRGYPVVEEVTGISDTPSLTEIQDIAQSAIGMFADETFDKLTIFYNEFVSPIVQRPVEKQLLPLTSEEVLDGPVSAYEYEPDSESVLEVLLPKYAETLIYSALLDAKASEFGARMTAMGNATDNATEMLETLTLQFNRARQAAITQEIAEIVAGANALR DIP protein Q71CG4 original sequence version: 18 A323CB37148BCD2C q71cg3_9baci ATP synthase subunit beta atpD ATP synthase F1 sector subunit beta F-ATPase subunit beta protein protein bacillus sp. ta2.a1 Bacillus sp. TA2.A1 MNKGRIIQVMGPVVDIQFESGQLPDIYNAITIERPQGGTLTVEAAVHLGDNVVRCVAMASTDGLVRGLEAVDTGAPISVPVGKATLGRVFNVLGEPIDEQGEVNAEERHPIHRPAPEFEELSTADEILETGIKVIDLLAPYAKGGKIGLFGGAGVGKTVLIQELINNVAQEHGGLSVFAGVGERTREGNDLYHEMKDSGVISKTSMVFGQMNEPPGARLRVALTGLTMAEYFRDREGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSITSIQAIYVPADDYTDPAPATTFAHLDATTNLERKLAEMGIYPAVDPLASTSRILSPAVVGEEHYRVARGVQQVLQRYNDLQDIIAILGMDELSDEDKLIVARARKIQRFLSQPFHVAEQFTGMPGKYVPVKETVRGFKEILEGKHDNLPEEAFYMVGTIDEAVEKAKKL DIP protein Q71CG3 original sequence version: 27 0766A76BD95A13C1 q71cg2_9baci ATP synthase epsilon chain atpC ATP synthase F1 sector epsilon subunit F-ATPase epsilon subunit protein protein bacillus sp. ta2.a1 Bacillus sp. TA2.A1 MATVQVDIVTPERKVFQGEADIVIARGVEGELGVMAGHIPLVTPLKTAPVRIKQGDKETLIAVSGGFLEVRPDKVNILADTAELPEEIDVERAKKAKARHETILKRLDKTDKDYLRHKRALERAEVRLQVANSKS DIP protein Q71CG2 original sequence version: 18 2D96C544D9E50EEA q71cg5_9baci ATP synthase subunit alpha atpA ATP synthase F1 sector subunit alpha F-ATPase subunit alpha protein protein bacillus sp. ta2.a1 Bacillus sp. TA2.A1 MSIRPEEISALIKKQIENYEADLEVVEVGTVIQVGDGIARVHGLEKVMAGELLEFENGVMGMAQNLEEDNVGVVILGPYTEIREGTQVKRTGRIMEVPVGEALLGRVVNPLGQPLDGRGPIETAEYRPIESPAPGVMDRKSVHEPLQTGIKAIDSMIPIGRGQRELIIGDRQTGKTTIAIDTIINQKGQDVICIYVAIGQKQSTVAGVVETLRQHDALDYTIVVTASASEPAPLLYLAPYAGCAMGEYFMYKGKHALVVYDDLSKQAAAYRELSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDEKGGGSLTALPFIETQAGDVSAYIPTNVISITDGQIFLESDLFYSGVRPAVNVGISVSRVGGAAQIKAMKKVAGTLRLDLAQYRELQAFAQFGSDLDKATQAKLNRGERTVEILKQDEHKPMPVEEQVISIYAVTNGFMDDIPVEDVRRFEEELLSFMRANKDSLLDHIRQTGELPDTKELDAAIEEFKKGFTPSA DIP protein Q71CG5 original sequence version: 25 19BA0640BE04CF15 atpa-atpc-2 2 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 4 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association atpa-atpc-3 3 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 4 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association atpa-atpc-4 1 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 4 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association