DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu DNMT3L connects unmethylated lysine 4 of histone H3 to de novo methylation of DNA. DNMT3L connects unmethylated lysine 4 of histone H3 to de novo methylation of DNA. Nature 2007 imex curation Ooi SK., Qiu C., Bernstein E., Li K., Jia D., Yang Z., Erdjument-Bromage H., Tempst P., Lin SP., Allis CD., Cheng X., Bestor TH. Only protein-protein interactions mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip fingerprinting peptide massfingerprinting fingerprinting Ooi SK., Qiu C., Bernstein E., Li K., Jia D., Yang Z., Erdjument-Bromage H., Tempst P., Lin SP., Allis CD., Cheng X., Bestor TH. DIP original experiment: DIP-253157X Nature 2007 IMEx DNMT3L connects unmethylated lysine 4 of histone H3 to de novo methylation of DNA. DNMT3L connects unmethylated lysine 4 of histone H3 to de novo methylation of DNA. DNMT3L connects unmethylated lysine 4 of histone H3 to de novo methylation of DNA. Nature 2007 imex curation Ooi SK., Qiu C., Bernstein E., Li K., Jia D., Yang Z., Erdjument-Bromage H., Tempst P., Lin SP., Allis CD., Cheng X., Bestor TH. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Ooi SK., Qiu C., Bernstein E., Li K., Jia D., Yang Z., Erdjument-Bromage H., Tempst P., Lin SP., Allis CD., Cheng X., Bestor TH. DIP original experiment: DIP-253161X Nature 2007 IMEx DNMT3L connects unmethylated lysine 4 of histone H3 to de novo methylation of DNA. DNMT3L connects unmethylated lysine 4 of histone H3 to de novo methylation of DNA. DNMT3L connects unmethylated lysine 4 of histone H3 to de novo methylation of DNA. Nature 2007 imex curation Ooi SK., Qiu C., Bernstein E., Li K., Jia D., Yang Z., Erdjument-Bromage H., Tempst P., Lin SP., Allis CD., Cheng X., Bestor TH. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Ooi SK., Qiu C., Bernstein E., Li K., Jia D., Yang Z., Erdjument-Bromage H., Tempst P., Lin SP., Allis CD., Cheng X., Bestor TH. DIP original experiment: DIP-253156X Nature 2007 IMEx DNMT3L connects unmethylated lysine 4 of histone H3 to de novo methylation of DNA. DNMT3L connects unmethylated lysine 4 of histone H3 to de novo methylation of DNA. DNMT3L connects unmethylated lysine 4 of histone H3 to de novo methylation of DNA. Nature 2007 imex curation Ooi SK., Qiu C., Bernstein E., Li K., Jia D., Yang Z., Erdjument-Bromage H., Tempst P., Lin SP., Allis CD., Cheng X., Bestor TH. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Ooi SK., Qiu C., Bernstein E., Li K., Jia D., Yang Z., Erdjument-Bromage H., Tempst P., Lin SP., Allis CD., Cheng X., Bestor TH. DIP original experiment: DIP-253164X Nature 2007 IMEx DNMT3L connects unmethylated lysine 4 of histone H3 to de novo methylation of DNA. DNMT3L connects unmethylated lysine 4 of histone H3 to de novo methylation of DNA. DNMT3L connects unmethylated lysine 4 of histone H3 to de novo methylation of DNA. Nature 2007 imex curation Ooi SK., Qiu C., Bernstein E., Li K., Jia D., Yang Z., Erdjument-Bromage H., Tempst P., Lin SP., Allis CD., Cheng X., Bestor TH. Only protein-protein interactions in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps predetermined predetermined participant predetermined Ooi SK., Qiu C., Bernstein E., Li K., Jia D., Yang Z., Erdjument-Bromage H., Tempst P., Lin SP., Allis CD., Cheng X., Bestor TH. DIP original experiment: DIP-253159X Nature 2007 IMEx DNMT3L connects unmethylated lysine 4 of histone H3 to de novo methylation of DNA. DNMT3L connects unmethylated lysine 4 of histone H3 to de novo methylation of DNA. DNMT3L connects unmethylated lysine 4 of histone H3 to de novo methylation of DNA. Nature 2007 imex curation Ooi SK., Qiu C., Bernstein E., Li K., Jia D., Yang Z., Erdjument-Bromage H., Tempst P., Lin SP., Allis CD., Cheng X., Bestor TH. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Ooi SK., Qiu C., Bernstein E., Li K., Jia D., Yang Z., Erdjument-Bromage H., Tempst P., Lin SP., Allis CD., Cheng X., Bestor TH. DIP original experiment: DIP-253163X Nature 2007 IMEx DNMT3L connects unmethylated lysine 4 of histone H3 to de novo methylation of DNA. DNMT3L connects unmethylated lysine 4 of histone H3 to de novo methylation of DNA. DNMT3L connects unmethylated lysine 4 of histone H3 to de novo methylation of DNA. Nature 2007 imex curation Ooi SK., Qiu C., Bernstein E., Li K., Jia D., Yang Z., Erdjument-Bromage H., Tempst P., Lin SP., Allis CD., Cheng X., Bestor TH. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Ooi SK., Qiu C., Bernstein E., Li K., Jia D., Yang Z., Erdjument-Bromage H., Tempst P., Lin SP., Allis CD., Cheng X., Bestor TH. DIP original experiment: DIP-253158X Nature 2007 IMEx DNMT3L connects unmethylated lysine 4 of histone H3 to de novo methylation of DNA. DNMT3L connects unmethylated lysine 4 of histone H3 to de novo methylation of DNA. DNMT3L connects unmethylated lysine 4 of histone H3 to de novo methylation of DNA. Nature 2007 imex curation Ooi SK., Qiu C., Bernstein E., Li K., Jia D., Yang Z., Erdjument-Bromage H., Tempst P., Lin SP., Allis CD., Cheng X., Bestor TH. Only protein-protein interactions in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps predetermined predetermined participant predetermined Ooi SK., Qiu C., Bernstein E., Li K., Jia D., Yang Z., Erdjument-Bromage H., Tempst P., Lin SP., Allis CD., Cheng X., Bestor TH. DIP original experiment: DIP-253162X Nature 2007 IMEx DNMT3L connects unmethylated lysine 4 of histone H3 to de novo methylation of DNA. DNMT3L connects unmethylated lysine 4 of histone H3 to de novo methylation of DNA. DNMT3L connects unmethylated lysine 4 of histone H3 to de novo methylation of DNA. Nature 2007 imex curation Ooi SK., Qiu C., Bernstein E., Li K., Jia D., Yang Z., Erdjument-Bromage H., Tempst P., Lin SP., Allis CD., Cheng X., Bestor TH. Only protein-protein interactions mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Ooi SK., Qiu C., Bernstein E., Li K., Jia D., Yang Z., Erdjument-Bromage H., Tempst P., Lin SP., Allis CD., Cheng X., Bestor TH. DIP original experiment: DIP-253160X Nature 2007 IMEx DNMT3L connects unmethylated lysine 4 of histone H3 to de novo methylation of DNA. q9ujw3-1 DNA (cytosine-5)-methyltransferase 3-like DNMT3L protein protein human Homo sapiens Human MAAIPALDPEAEPSMDVILVGSSELSSSVSPGTGRDLIAYEVKANQRNIEDICICCGSLQVHTQHPLFEGGICAPCKDKFLDALFLYDDDGYQSYCSICCSGETLLICGNPDCTRCYCFECVDSLVGPGTSGKVHAMSNWVCYLCLPSSRSGLLQRRRKWRSQLKAFYDRESENPLEMFETVPVWRRQPVRVLSLFEDIKKELTSLGFLESGSDPGQLKHVVDVTDTVRKDVEEWGPFDLVYGATPPLGHTCDRPPSWYLFQFHRLLQYARPKPGSPRPFFWMFVDNLVLNKEDLDVASRFLEMEPVTIPDVHGGSLQNAVRVWSNIPAIRSRHWALVSEEELSLLAQNKQSSKLAAKWPTKLVKNCFLPLREYFKYFSTELTSSL DIP protein Q9UJW3-1 original sequence version: 123 DIP protein Q9UJW3 original sequence version: 107 wdr5_human WD repeat-containing protein 5 BMP2-induced 3-kb gene protein WDR5 BIG3 protein protein human Homo sapiens Human MATEEKKPETEAARAQPTPSSSATQSKPTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC DIP protein P61964 original sequence version: 35 DIP protein P61964 original sequence version: 131 DIP protein P61964 original sequence version: 83 DIP protein P61964 original sequence version: 84 DIP protein P61964 original sequence version: 87 DIP protein P61964 original sequence version: 116 DIP protein P61964 original sequence version: 130 DIP protein P61964 original sequence version: 113 DIP protein P61964 original sequence version: 112 DIP protein P61964 original sequence version: 99 4BF30914A2250286 dnm3b_mouse DNA (cytosine-5)-methyltransferase 3B Dnmt3b DNA methyltransferase MmuIIIB protein protein mouse Mus musculus Mouse MKGDSRHLNEEEGASGYEECIIVNGNFSDQSSDTKDAPSPPVLEAICTEPVCTPETRGRRSSSRLSKREVSSLLNYTQDMTGDGDRDDEVDDGNGSDILMPKLTRETKDTRTRSESPAVRTRHSNGTSSLERQRASPRITRGRQGRHHVQEYPVEFPATRSRRRRASSSASTPWSSPASVDFMEEVTPKSVSTPSVDLSQDGDQEGMDTTQVDAESRDGDSTEYQDDKEFGIGDLVWGKIKGFSWWPAMVVSWKATSKRQAMPGMRWVQWFGDGKFSEISADKLVALGLFSQHFNLATFNKLVSYRKAMYHTLEKARVRAGKTFSSSPGESLEDQLKPMLEWAHGGFKPTGIEGLKPNKKQPVVNKSKVRRSDSRNLEPRRRENKSRRRTTNDSAASESPPPKRLKTNSYGGKDRGEDEESRERMASEVTNNKGNLEDRCLSCGKKNPVSFHPLFEGGLCQSCRDRFLELFYMYDEDGYQSYCTVCCEGRELLLCSNTSCCRCFCVECLEVLVGAGTAEDAKLQEPWSCYMCLPQRCHGVLRRRKDWNMRLQDFFTTDPDLEEFEPPKLYPAIPAAKRRPIRVLSLFDGIATGYLVLKELGIKVEKYIASEVCAESIAVGTVKHEGQIKYVNDVRKITKKNIEEWGPFDLVIGGSPCNDLSNVNPARKGLYEGTGRLFFEFYHLLNYTRPKEGDNRPFFWMFENVVAMKVNDKKDISRFLACNPVMIDAIKVSAAHRARYFWGNLPGMNRPVMASKNDKLELQDCLEFSRTAKLKKVQTITTKSNSIRQGKNQLFPVVMNGKDDVLWCTELERIFGFPAHYTDVSNMGRGARQKLLGRSWSVPVIRHLFAPLKDYFACE DIP protein O88509 original sequence version: 74 DIP protein O88509 original sequence version: 95 DIP protein O88509 original sequence version: 117 mint Required for genome wide de novo methylation and is essential for development. DNA methylation is coordinated with methylation of histones 93E334D9FBCC590E h4_mouse Histone H4 H4c11 H4c12 H4c14 H4c2 H4c3 H4c4 H4c6 H4c8 H4c9 H4f16 Hist1h4a Hist4h4 Hist1h4b Hist1h4c Hist1h4d Hist1h4f Hist1h4h Hist1h4i Hist1h4j Hist1h4k Hist2h4a Hist2h4 Hist1h4m H4-53 H4-12 H4c1 protein protein mouse Mus musculus Mouse MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG DIP protein P62806 original sequence version: 108 A9E5DFD3F8B97598 h3tail H3 tail peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) ARTKQTARKSTGGKAPRKQL o88508-1 DNA (cytosine-5)-methyltransferase 3A Cysteine methyltransferase DNMT3A Dnmt3a DNA methyltransferase MmuIIIA protein protein mouse Mus musculus Mouse MPSSGPGDTSSSSLEREDDRKEGEEQEENRGKEERQEPSATARKVGRPGRKRKHPPVESSDTPKDPAVTTKSQPMAQDSGPSDLLPNGDLEKRSEPQPEEGSPAAGQKGGAPAEGEGTETPPEASRAVENGCCVTKEGRGASAGEGKEQKQTNIESMKMEGSRGRLRGGLGWESSLRQRPMPRLTFQAGDPYYISKRKRDEWLARWKREAEKKAKVIAVMNAVEENQASGESQKVEEASPPAVQQPTDPASPTVATTPEPVGGDAGDKNATKAADDEPEYEDGRGFGIGELVWGKLRGFSWWPGRIVSWWMTGRSRAAEGTRWVMWFGDGKFSVVCVEKLMPLSSFCSAFHQATYNKQPMYRKAIYEVLQVASSRAGKLFPACHDSDESDSGKAVEVQNKQMIEWALGGFQPSGPKGLEPPEEEKNPYKEVYTDMWVEPEAAAYAPPPPAKKPRKSTTEKPKVKEIIDERTRERLVYEVRQKCRNIEDICISCGSLNVTLEHPLFIGGMCQNCKNCFLECAYQYDDDGYQSYCTICCGGREVLMCGNNNCCRCFCVECVDLLVGPGAAQAAIKEDPWNCYMCGHKGTYGLLRRREDWPSRLQMFFANNHDQEFDPPKVYPPVPAEKRKPIRVLSLFDGIATGLLVLKDLGIQVDRYIASEVCEDSITVGMVRHQGKIMYVGDVRSVTQKHIQEWGPFDLVIGGSPCNDLSIVNPARKGLYEGTGRLFFEFYRLLHDARPKEGDDRPFFWLFENVVAMGVSDKRDISRFLESNPVMIDAKEVSAAHRARYFWGNLPGMNRPLASTVNDKLELQECLEHGRIAKFSKVRTITTRSNSIKQGKDQHFPVFMNEKEDILWCTEMERVFGFPVHYTDVSNMSRLARQRLLGRSWSVPVIRHLFAPLKEYFACV DIP protein O88508-1 original sequence version: 135 DIP protein O88508 original sequence version: 84 DIP protein O88508-1 original sequence version: 84 DIP protein O88508 original sequence version: 135 cbx5_human Chromobox protein homolog 5 CBX5 Heterochromatin protein 1 homolog alpha Antigen p25 HP1A protein protein human Homo sapiens Human MGKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKETAKS DIP protein P45973 original sequence version: 138 DIP protein P45973 original sequence version: 116 DIP protein P45973 original sequence version: 115 DIP protein P45973 original sequence version: 124 DIP protein P45973 original sequence version: 154 DIP protein P45973 original sequence version: 132 DIP protein P45973 original sequence version: 155 16FFC476367093B1 dnm3l_mouse DNA (cytosine-5)-methyltransferase 3-like Dnmt3l protein protein mouse Mus musculus Mouse MGSRETPSSCSKTLETLDLETSDSSSPDADSPLEEQWLKSSPALKEDSVDVVLEDCKEPLSPSSPPTGREMIRYEVKVNRRSIEDICLCCGTLQVYTRHPLFEGGLCAPCKDKFLESLFLYDDDGHQSYCTICCSGGTLFICESPDCTRCYCFECVDILVGPGTSERINAMACWVCFLCLPFSRSGLLQRRKRWRHQLKAFHDQEGAGPMEIYKTVSAWKRQPVRVLSLFRNIDKVLKSLGFLESGSGSGGGTLKYVEDVTNVVRRDVEKWGPFDLVYGSTQPLGSSCDRCPGWYMFQFHRILQYALPRQESQRPFFWIFMDNLLLTEDDQETTTRFLQTEAVTLQDVRGRDYQNAMRVWSNIPGLKSKHAPLTPKEEEYLQAQVRSRSKLDAPKVDLLVKNCLLPLREYFKYFSQNSLPL DIP protein Q9CWR8 original sequence version: 93 DIP protein Q9CWR8 original sequence version: 71 6C996D220C6F6D83 dnmt3l-h3(120)-1 3 14 unspecified role unspecified role unspecified role unspecified role Region 1-7 Region 1-7 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction h3(120)-dnmt3l-1 7 14 unspecified role unspecified role bait bait Biotin-tag Biotin-tag biotin tag biotin tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal K4me1 K4me1 n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys certain certain sequence position certain certain certain sequence position certain disrupting-ptm ptm disrupting an interaction disrupting-ptm K4me2 K4me2 n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain disrupting-ptm ptm disrupting an interaction disrupting-ptm K4me3 K4me3 n6me3+lys N6,N6,N6-trimethyl-L-lysine (5S)-5-amino-5-carboxy-N,N,N-trimethylpentan-1-aminium 2-amino-6-(trimethylammonio)hexanoic acid 5-azanyl-5-carboxy-N,N,N-trimethylpentanazanium MOD_RES N6,N6,N6-trimethyllysine N(zeta)-trimethyllysine N6,N6,N6-trimethyl-L-lysine N6,N6,N6-trimethylated L-lysine N6,N6,N6-trimethyllysin-N6-ium N6,N6,N6-trimethyllysine cation epsilon-trimethyllysine N-trimethylation (of lysine) N6Me3+Lys Trimethyl tri-Methylation certain certain sequence position certain certain certain sequence position certain disrupting-ptm ptm disrupting an interaction disrupting-ptm in vitro In vitro 10 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction dnmt3l-h3(120)-2 8 14 unspecified role unspecified role unspecified role unspecified role Fluorescein-tag Fluorescein-tag fluorescein fluorescein label fluorescein c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal in vitro In vitro 10 unspecified role unspecified role unspecified role unspecified role Q9UJW3-1:p.Ile107Trp I107W mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain I W This feature has been corrected as a result of our quality control procedures. The original label was 'I107W'. Wed May 02 19:52:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile107trp' Tue Jun 30 16:51:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile107Trp' Q9UJW3-1:p.Asp90Ala D90A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain D A This feature has been corrected as a result of our quality control procedures. The original label was 'D90A'. Wed May 02 17:46:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp90ala' Tue Jun 30 19:29:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp90Ala' ecolx Escherichia coli direct interaction direct interaction h3(120)-wdr5-1 6 11 unspecified role unspecified role prey prey ecolx Escherichia coli 14 unspecified role unspecified role bait bait Biotin-tag Biotin-tag biotin tag biotin tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal K4me1 K4me1 n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys certain certain sequence position certain certain certain sequence position certain prerequisite-ptm prerequisite-ptm prerequisite ptm required ptm prerequisite-ptm required-ptm K4me2 K4me2 n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain prerequisite-ptm prerequisite-ptm prerequisite ptm required ptm prerequisite-ptm required-ptm K4me3 K4me3 n6me3+lys N6,N6,N6-trimethyl-L-lysine (5S)-5-amino-5-carboxy-N,N,N-trimethylpentan-1-aminium 2-amino-6-(trimethylammonio)hexanoic acid 5-azanyl-5-carboxy-N,N,N-trimethylpentanazanium MOD_RES N6,N6,N6-trimethyllysine N(zeta)-trimethyllysine N6,N6,N6-trimethyl-L-lysine N6,N6,N6-trimethylated L-lysine N6,N6,N6-trimethyllysin-N6-ium N6,N6,N6-trimethyllysine cation epsilon-trimethyllysine N-trimethylation (of lysine) N6Me3+Lys Trimethyl tri-Methylation certain certain sequence position certain certain certain sequence position certain prerequisite-ptm prerequisite-ptm prerequisite ptm required ptm prerequisite-ptm required-ptm in vitro In vitro direct interaction direct interaction dnmt3l-dnmt3a-3 9 15 unspecified role unspecified role prey prey mouse Mus musculus Mouse 17 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range mouse Mus musculus Mouse physical association physical association dnmt3l-dnmt3a-4 1 12 unspecified role unspecified role prey prey mouse Mus musculus Mouse 13 unspecified role unspecified role prey prey mouse Mus musculus Mouse 15 unspecified role unspecified role prey prey mouse Mus musculus Mouse 17 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range mouse Mus musculus Mouse association association dnmt3l-h3(120)-3 5 14 unspecified role unspecified role unspecified role unspecified role Fluorescein-tag Fluorescein-tag fluorescein fluorescein label fluorescein c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal K4me1 K4me1 n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys certain certain sequence position certain certain certain sequence position certain decreasing-ptm ptm decreasing an interaction decreasing-ptm K4me2 K4me2 n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain decreasing-ptm ptm decreasing an interaction decreasing-ptm K4me3 K4me3 n6me3+lys N6,N6,N6-trimethyl-L-lysine (5S)-5-amino-5-carboxy-N,N,N-trimethylpentan-1-aminium 2-amino-6-(trimethylammonio)hexanoic acid 5-azanyl-5-carboxy-N,N,N-trimethylpentanazanium MOD_RES N6,N6,N6-trimethyllysine N(zeta)-trimethyllysine N6,N6,N6-trimethyl-L-lysine N6,N6,N6-trimethylated L-lysine N6,N6,N6-trimethyllysin-N6-ium N6,N6,N6-trimethyllysine cation epsilon-trimethyllysine N-trimethylation (of lysine) N6Me3+Lys Trimethyl tri-Methylation certain certain sequence position certain certain certain sequence position certain decreasing-ptm ptm decreasing an interaction decreasing-ptm in vitro In vitro 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction h3(120)-dnmt3l-2 2 14 unspecified role unspecified role bait bait Biotin-tag Biotin-tag biotin tag biotin tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal in vitro In vitro 10 unspecified role unspecified role prey prey Q9UJW3-1:p.Ile107Trp I107W mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain I W This feature has been corrected as a result of our quality control procedures. The original label was 'I107W'. Wed May 02 15:25:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile107trp' Tue Jun 30 19:19:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile107Trp' Q9UJW3-1:p.Asp90Ala D90A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain D A This feature has been corrected as a result of our quality control procedures. The original label was 'D90A'. Wed May 02 15:54:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp90ala' Tue Jun 30 18:53:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp90Ala' ecolx Escherichia coli direct interaction direct interaction h3(120)-cbx5-1 4 16 unspecified role unspecified role prey prey ecolx Escherichia coli 14 unspecified role unspecified role bait bait Biotin-tag Biotin-tag biotin tag biotin tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal K9me1 K9me1 n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys certain certain sequence position certain certain certain sequence position certain prerequisite-ptm prerequisite-ptm prerequisite ptm required ptm prerequisite-ptm required-ptm K9me2 K9me2 n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain prerequisite-ptm prerequisite-ptm prerequisite ptm required ptm prerequisite-ptm required-ptm K9me3 K9me3 n6me3+lys N6,N6,N6-trimethyl-L-lysine (5S)-5-amino-5-carboxy-N,N,N-trimethylpentan-1-aminium 2-amino-6-(trimethylammonio)hexanoic acid 5-azanyl-5-carboxy-N,N,N-trimethylpentanazanium MOD_RES N6,N6,N6-trimethyllysine N(zeta)-trimethyllysine N6,N6,N6-trimethyl-L-lysine N6,N6,N6-trimethylated L-lysine N6,N6,N6-trimethyllysin-N6-ium N6,N6,N6-trimethyllysine cation epsilon-trimethyllysine N-trimethylation (of lysine) N6Me3+Lys Trimethyl tri-Methylation certain certain sequence position certain certain certain sequence position certain prerequisite-ptm prerequisite-ptm prerequisite ptm required ptm prerequisite-ptm required-ptm in vitro In vitro direct interaction direct interaction