DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu CCDC98 targets BRCA1 to DNA damage sites. CCDC98 targets BRCA1 to DNA damage sites. Nature structural & molecular biology 2007 imex curation Liu Z., Wu J., Yu X. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Liu Z., Wu J., Yu X. DIP original experiment: DIP-68084X Nature structural & molecular biology 2007 IMEx CCDC98 targets BRCA1 to DNA damage sites. CCDC98 targets BRCA1 to DNA damage sites. CCDC98 targets BRCA1 to DNA damage sites. Nature structural & molecular biology 2007 imex curation Liu Z., Wu J., Yu X. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Liu Z., Wu J., Yu X. DIP original experiment: DIP-68081X Nature structural & molecular biology 2007 IMEx CCDC98 targets BRCA1 to DNA damage sites. CCDC98 targets BRCA1 to DNA damage sites. CCDC98 targets BRCA1 to DNA damage sites. Nature structural & molecular biology 2007 imex curation Liu Z., Wu J., Yu X. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Liu Z., Wu J., Yu X. DIP original experiment: DIP-68087X Nature structural & molecular biology 2007 IMEx CCDC98 targets BRCA1 to DNA damage sites. CCDC98 targets BRCA1 to DNA damage sites. CCDC98 targets BRCA1 to DNA damage sites. Nature structural & molecular biology 2007 imex curation Liu Z., Wu J., Yu X. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Liu Z., Wu J., Yu X. DIP original experiment: DIP-68085X Nature structural & molecular biology 2007 IMEx CCDC98 targets BRCA1 to DNA damage sites. CCDC98 targets BRCA1 to DNA damage sites. CCDC98 targets BRCA1 to DNA damage sites. Nature structural & molecular biology 2007 imex curation Liu Z., Wu J., Yu X. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Liu Z., Wu J., Yu X. DIP original experiment: DIP-68088X Nature structural & molecular biology 2007 IMEx CCDC98 targets BRCA1 to DNA damage sites. CCDC98 targets BRCA1 to DNA damage sites. CCDC98 targets BRCA1 to DNA damage sites. Nature structural & molecular biology 2007 imex curation Liu Z., Wu J., Yu X. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Liu Z., Wu J., Yu X. DIP original experiment: DIP-68086X Nature structural & molecular biology 2007 IMEx CCDC98 targets BRCA1 to DNA damage sites. CCDC98 targets BRCA1 to DNA damage sites. CCDC98 targets BRCA1 to DNA damage sites. Nature structural & molecular biology 2007 imex curation Liu Z., Wu J., Yu X. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Liu Z., Wu J., Yu X. DIP original experiment: DIP-68083X Nature structural & molecular biology 2007 IMEx CCDC98 targets BRCA1 to DNA damage sites. CCDC98 targets BRCA1 to DNA damage sites. CCDC98 targets BRCA1 to DNA damage sites. Nature structural & molecular biology 2007 imex curation Liu Z., Wu J., Yu X. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Liu Z., Wu J., Yu X. DIP original experiment: DIP-68082X Nature structural & molecular biology 2007 IMEx CCDC98 targets BRCA1 to DNA damage sites. q96rl1-1 BRCA1-A complex subunit RAP80 UIMC1 RXRIP110 Receptor-associated protein 80 Retinoid X receptor-interacting protein 110 Ubiquitin interaction motif-containing protein 1 RAP80 protein protein human Homo sapiens Human MPRRKKKVKEVSESRNLEKKDVETTSSVSVKRKRRLEDAFIVISDSDGEEPKEENGLQKTKTKQSNRAKCLAKRKIAQMTEEEQFALALKMSEQEAREVNSQEEEEEELLRKAIAESLNSCRPSDASATRSRPLATGPSSQSHQEKTTDSGLTEGIWQLVPPSLFKGSHISQGNEAEEREEPWDHTEKTEEEPVSGSSGSWDQSSQPVFENVNVKSFDRCTGHSAEHTQCGKPQESTGRGSAFLKAVQGSGDTSRHCLPTLADAKGLQDTGGTVNYFWGIPFCPDGVDPNQYTKVILCQLEVYQKSLKMAQRQLLNKKGFGEPVLPRPPSLIQNECGQGEQASEKNECISEDMGDEDKEERQESRASDWHSKTKDFQESSIKSLKEKLLLEEEPTTSHGQSSQGIVEETSEEGNSVPASQSVAALTSKRSLVLMPESSAEEITVCPETQLSSSETFDLEREVSPGSRDILDGVRIIMADKEVGNKEDAEKEVAISTFSSSNQVSCPLCDQCFPPTKIERHAMYCNGLMEEDTVLTRRQKEAKTKSDSGTAAQTSLDIDKNEKCYLCKSLVPFREYQCHVDSCLQLAKADQGDGPEGSGRACSTVEGKWQQRLKNPKEKGHSEGRLLSFLEQSEHKTSDADIKSSETGAFRVPSPGMEEAGCSREMQSSFTRRDLNESPVKSFVSISEATDCLVDFKKQVTVQPGSRTRTKAGRGRRRKF DIP protein Q96RL1-1 original sequence version: 42 DIP protein Q96RL1-1 original sequence version: 77 DIP protein Q96RL1 original sequence version: 96 DIP protein Q96RL1 original sequence version: 99 DIP protein Q96RL1-1 original sequence version: 45 DIP protein Q96RL1 original sequence version: 45 DIP protein Q96RL1 original sequence version: 67 56B7699E42395861 brca1_human Breast cancer type 1 susceptibility protein BRCA1 RNF53 RING finger protein 53 RING-type E3 ubiquitin transferase BRCA1 protein protein human Homo sapiens Human MDLSALRVEEVQNVINAMQKILECPICLELIKEPVSTKCDHIFCKFCMLKLLNQKKGPSQCPLCKNDITKRSLQESTRFSQLVEELLKIICAFQLDTGLEYANSYNFAKKENNSPEHLKDEVSIIQSMGYRNRAKRLLQSEPENPSLQETSLSVQLSNLGTVRTLRTKQRIQPQKTSVYIELGSDSSEDTVNKATYCSVGDQELLQITPQGTRDEISLDSAKKAACEFSETDVTNTEHHQPSNNDLNTTEKRAAERHPEKYQGSSVSNLHVEPCGTNTHASSLQHENSSLLLTKDRMNVEKAEFCNKSKQPGLARSQHNRWAGSKETCNDRRTPSTEKKVDLNADPLCERKEWNKQKLPCSENPRDTEDVPWITLNSSIQKVNEWFSRSDELLGSDDSHDGESESNAKVADVLDVLNEVDEYSGSSEKIDLLASDPHEALICKSERVHSKSVESNIEDKIFGKTYRKKASLPNLSHVTENLIIGAFVTEPQIIQERPLTNKLKRKRRPTSGLHPEDFIKKADLAVQKTPEMINQGTNQTEQNGQVMNITNSGHENKTKGDSIQNEKNPNPIESLEKESAFKTKAEPISSSISNMELELNIHNSKAPKKNRLRRKSSTRHIHALELVVSRNLSPPNCTELQIDSCSSSEEIKKKKYNQMPVRHSRNLQLMEGKEPATGAKKSNKPNEQTSKRHDSDTFPELKLTNAPGSFTKCSNTSELKEFVNPSLPREEKEEKLETVKVSNNAEDPKDLMLSGERVLQTERSVESSSISLVPGTDYGTQESISLLEVSTLGKAKTEPNKCVSQCAAFENPKGLIHGCSKDNRNDTEGFKYPLGHEVNHSRETSIEMEESELDAQYLQNTFKVSKRQSFAPFSNPGNAEEECATFSAHSGSLKKQSPKVTFECEQKEENQGKNESNIKPVQTVNITAGFPVVGQKDKPVDNAKCSIKGGSRFCLSSQFRGNETGLITPNKHGLLQNPYRIPPLFPIKSFVKTKCKKNLLEENFEEHSMSPEREMGNENIPSTVSTISRNNIRENVFKEASSSNINEVGSSTNEVGSSINEIGSSDENIQAELGRNRGPKLNAMLRLGVLQPEVYKQSLPGSNCKHPEIKKQEYEEVVQTVNTDFSPYLISDNLEQPMGSSHASQVCSETPDDLLDDGEIKEDTSFAENDIKESSAVFSKSVQKGELSRSPSPFTHTHLAQGYRRGAKKLESSEENLSSEDEELPCFQHLLFGKVNNIPSQSTRHSTVATECLSKNTEENLLSLKNSLNDCSNQVILAKASQEHHLSEETKCSASLFSSQCSELEDLTANTNTQDPFLIGSSKQMRHQSESQGVGLSDKELVSDDEERGTGLEENNQEEQSMDSNLGEAASGCESETSVSEDCSGLSSQSDILTTQQRDTMQHNLIKLQQEMAELEAVLEQHGSQPSNSYPSIISDSSALEDLRNPEQSTSEKAVLTSQKSSEYPISQNPEGLSADKFEVSADSSTSKNKEPGVERSSPSKCPSLDDRWYMHSCSGSLQNRNYPSQEELIKVVDVEEQQLEESGPHDLTETSYLPRQDLEGTPYLESGISLFSDDPESDPSEDRAPESARVGNIPSSTSALKVPQLKVAESAQSPAAAHTTDTAGYNAMEESVSREKPELTASTERVNKRMSMVVSGLTPEEFMLVYKFARKHHITLTNLITEETTHVVMKTDAEFVCERTLKYFLGIAGGKWVVSYFWVTQSIKERKMLNEHDFEVRGDVVNGRNHQGPKRARESQDRKIFRGLEICCYGPFTNMPTDQLEWMVQLCGASVVKELSSFTLGTGVHPIVVVQPDAWTEDNGFHAIGQMCEAPVVTREWVLDSVALYQCQELDTYLIPQIPHSHY DIP protein P38398 original sequence version: 183 DIP protein P38398 original sequence version: 111 DIP protein P38398 original sequence version: 149 DIP protein P38398-1 original sequence version: 149 DIP protein P38398 original sequence version: 142 DIP protein P38398 original sequence version: 212 DIP protein P38398 original sequence version: 163 DIP protein P38398 original sequence version: 185 DIP protein P38398 original sequence version: 148 DIP protein P38398 original sequence version: 210 89C6D83FF56312AF abrx1_human BRCA1-A complex subunit Abraxas 1 ABRAXAS1 ABRA1 CCDC98 Coiled-coil domain-containing protein 98 FAM175A Protein FAM175A UNQ496/PRO1013 protein protein human Homo sapiens Human MEGESTSAVLSGFVLGALAFQHLNTDSDTEGFLLGEVKGEAKNSITDSQMDDVEVVYTIDIQKYIPCYQLFSFYNSSGEVNEQALKKILSNVKKNVVGWYKFRRHSDQIMTFRERLLHKNLQEHFSNQDLVFLLLTPSIITESCSTHRLEHSLYKPQKGLFHRVPLVVANLGMSEQLGYKTVSGSCMSTGFSRAVQTHSSKFFEEDGSLKEVHKINEMYASLQEELKSICKKVEDSEQAVDKLVKDVNRLKREIEKRRGAQIQAAREKNIQKDPQENIFLCQALRTFFPNSEFLHSCVMSLKNRHVSKSSCNYNHHLDVVDNLTLMVEHTDIPEASPASTPQIIKHKALDLDDRWQFKRSRLLDTQDKRSKADTGSSNQDKASKMSSPETDEEIEKMKGFGEYSRSPTF DIP protein Q6UWZ7 original sequence version: 25 This sequence has been withdrawn from Uniprot. A1ACA4F759BD1AEE fam175a-uimc1-1 7 9 unspecified role unspecified role prey prey human Homo sapiens Human 11 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association uimc1-fam175a-1 1 9 unspecified role unspecified role bait bait human Homo sapiens Human 11 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association brca1-fam175a-1 6 10 unspecified role unspecified role bait bait 1599-1863 binding region 1599-1863 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 11 unspecified role unspecified role prey prey Q6UWZ7:p.Ser406Ala S406A mutation mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain S A This feature has been corrected as a result of our quality control procedures. The original label was 'S406A mutation'. Wed May 02 19:40:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser406ala' Tue Jun 30 16:13:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser406Ala' human Homo sapiens Human physical association physical association brca1-fam175a-2 2 10 unspecified role unspecified role bait bait human Homo sapiens Human 11 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association uimc1-brca1-1 5 9 unspecified role unspecified role bait bait human Homo sapiens Human 10 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association brca1-uimc1-1 3 9 unspecified role unspecified role prey prey human Homo sapiens Human 10 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association brca1-fam175a-3 4 10 unspecified role unspecified role bait bait 1599-1863 binding region 1599-1863 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 11 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association fam175a-brca1-1 8 10 unspecified role unspecified role prey prey human Homo sapiens Human 11 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association