DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu A bacterial E3 ubiquitin ligase targets a host protein kinase to disrupt plant immunity. A bacterial E3 ubiquitin ligase targets a host protein kinase to disrupt plant immunity. Nature 2007 imex curation Rosebrock TR., Zeng L., Brady JJ., Abramovitch RB., Xiao F., Martin GB. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Rosebrock TR., Zeng L., Brady JJ., Abramovitch RB., Xiao F., Martin GB. DIP original experiment: DIP-253180X Nature 2007 IMEx A bacterial E3 ubiquitin ligase targets a host protein kinase to disrupt plant immunity. A bacterial E3 ubiquitin ligase targets a host protein kinase to disrupt plant immunity. A bacterial E3 ubiquitin ligase targets a host protein kinase to disrupt plant immunity. Nature 2007 imex curation Rosebrock TR., Zeng L., Brady JJ., Abramovitch RB., Xiao F., Martin GB. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Rosebrock TR., Zeng L., Brady JJ., Abramovitch RB., Xiao F., Martin GB. DIP original experiment: DIP-253179X Nature 2007 IMEx A bacterial E3 ubiquitin ligase targets a host protein kinase to disrupt plant immunity. A bacterial E3 ubiquitin ligase targets a host protein kinase to disrupt plant immunity. A bacterial E3 ubiquitin ligase targets a host protein kinase to disrupt plant immunity. Nature 2007 imex curation Rosebrock TR., Zeng L., Brady JJ., Abramovitch RB., Xiao F., Martin GB. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Rosebrock TR., Zeng L., Brady JJ., Abramovitch RB., Xiao F., Martin GB. DIP original experiment: DIP-253181X Nature 2007 IMEx A bacterial E3 ubiquitin ligase targets a host protein kinase to disrupt plant immunity. q40126_solpi Fen protein protein solpi Solanum pimpinellifolium Currant tomato Lycopersicon pimpinellifolium MGSKYSKATNSINDASNLSYGVPFENYRVPFVDLEEATNNFDDNFFIGEGGFGKVYRGVLRDGTKVALKKHKPESSQGIEEFETEIEILSFCSHPHLVSLIGFCDERNEMILIYDYMENGNLKSHLYGSDLPSMSWEQRLEICIGAARGLHYLHKNAVIHRDVKCTNILLDENFVPKITDFGISKTMPELDQTHLSTVVRGNIGYIAPEYALWGQLTEKSDVYSFGVVLFEVLCARPALDRSEIMSLDDETQKMGQLEQIVDPTIAAKIRPESLRMFGETAIKCLAPSSKNRPSMGDVLWKLEYALCLQEPTIQDDPE DIP protein Q40126 original sequence version: 92 q9lld3_solpi protein protein solpi Solanum pimpinellifolium Currant tomato Lycopersicon pimpinellifolium MGSKYSKATNSISDASNSRYGVPFENYRVPLVDLEEATNNFDDNFFIAEGGFGKVYRGVLRDGTKVALKRHNCDSQQSIEEFRTEIEILSRRSHPHLVSLIGYCDGRNEMILIYDYMENGNLKSHLYGSDLPSMSWEQRLEICIGAARGLHYLHTNGVMHRDVKSSNILLDENFVPKITDFGLSKTRPQLYQTHVSTDVKGTFGYIDPEYFIKGRLTEKSDVYSFGVVLFEVLCARSAIVQSLPSEMVNLAEWAVESHNNGQLEQIIDPNLAAKIRPESLRKFGETAVKCLALSSEDRPSMGDVLWKLEYALRLQESVI DIP protein Q9LLD3 original sequence version: 67 q40234_solpi Pto protein protein solpi Solanum pimpinellifolium Currant tomato Lycopersicon pimpinellifolium MGSKYSKATNSINDALSSSYLVPFESYRVPLVDLEEATNNFDHKFLIGHGVFGKVYKGVLRDGAKVALKRRTPESSQGIEEFETEIETLSFCRHPHLVSLIGFCDERNEMILIYKYMENGNLKRHLYGSDLPTMSMSWEQRLEICIGAARGLHYLHTRAIIHRDVKSINILLDENFVPKITDFGISKKGTELDQTHLSTVVKGTLGYIDPEYFIKGRLTEKSDVYSFGVVLFEVLCARSAIVQSLPREMVNLAEWAVESHNNGQLEQIVDPNLADKIRPESLRKFGDTAVKCLALSSEDRPSMGDVLWKLEYALRLQESVI DIP protein Q40234 original sequence version: 100 mint 3258F4BA1491151D hpab2_psesm Effector protein HopAB2 hopAB2 avrPtoB PSPTO_3087 Avirulence protein AvrPtoB protein protein psesm Pseudomonas syringae pv. tomato (strain DC3000) MAGINRAGPSGAYFVGHTDPEPVSGQAHGSGSGASSSNSPQVQPRPSNTPPSNAPAPPPTGRERLSRSTALSRQTREWLEQGMPTAEDASVRRRPQVTADAATPRAEARRTPEATADASAPRRGAVAHANSIVQQLVSEGADISHTRNMLRNAMNGDAVAFSRVEQNIFRQHFPNMPMHGISRDSELAIELRGALRRAVHQQAASAPVRSPTPTPASPAASSSGSSQRSLFGRFARLMAPNQGRSSNTAASQTPVDRSPPRVNQRPIRVDRAAMRNRGNDEADAALRGLVQQGVNLEHLRTALERHVMQRLPIPLDIGSALQNVGINPSIDLGESLVQHPLLNLNVALNRMLGLRPSAERAPRPAVPVAPATASRRPDGTRATRLRVMPEREDYENNVAYGVRLLNLNPGVGVRQAVAAFVTDRAERPAVVANIRAALDPIASQFSQLRTISKADAESEELGFKDAADHHTDDVTHCLFGGELSLSNPDQQVIGLAGNPTDTSQPYSQEGNKDLAFMDMKKLAQFLAGKPEHPMTRETLNAENIAKYAFRIVP DIP protein Q8RSY1 original sequence version: 72 DIP protein Q8RSY1 original sequence version: 79 hopab2-q9lld3_solpi-1 3 5 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 7 unspecified role unspecified role bait bait Region 1-307 Region 1-307 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Q8RSY1:p.[Phe479Ala;Phe525Ala;Pro533Ala] F479A/F525A/P533A mutation increasing strength mutation increasing interaction strength mutation increasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain P A certain certain sequence position certain certain certain sequence position certain F A certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F479A/F525A/P533A'. Wed May 02 15:29:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe479ala,phe525ala,pro533ala' Tue Jun 30 19:22:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe479Ala;Phe525Ala;Pro533Ala]' Q8RSY1:p.[Lys512Arg;Lys520Arg;Lys521Arg;Lys529Arg] K512R/K520R/K521R/K529R mutation increasing strength mutation increasing interaction strength mutation increasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain K R certain certain sequence position certain certain certain sequence position certain K R certain certain sequence position certain certain certain sequence position certain K R certain certain sequence position certain certain certain sequence position certain K R This feature has been corrected as a result of our quality control procedures. The original label was 'K512R/K520R/K521R/K529R'. Wed May 02 16:50:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys512arg,lys520arg,lys521arg,lys529arg' Tue Jun 30 15:44:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys512Arg;Lys520Arg;Lys521Arg;Lys529Arg]' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association hopab2-fen-1 2 4 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 7 unspecified role unspecified role bait bait Region 1-387 Region 1-387 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Q8RSY1:p.[Phe479Ala;Phe525Ala;Pro533Ala] F479A/F525A/P533A mutation increasing strength mutation increasing interaction strength mutation increasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain P A certain certain sequence position certain certain certain sequence position certain F A certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F479A/F525A/P533A'. Wed May 02 19:59:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe479ala,phe525ala,pro533ala' Tue Jun 30 17:41:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe479Ala;Phe525Ala;Pro533Ala]' Q8RSY1:p.[Lys512Arg;Lys520Arg;Lys521Arg;Lys529Arg] K512R/K520R/K521R/K529R mutation increasing strength mutation increasing interaction strength mutation increasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain K R certain certain sequence position certain certain certain sequence position certain K R certain certain sequence position certain certain certain sequence position certain K R certain certain sequence position certain certain certain sequence position certain K R This feature has been corrected as a result of our quality control procedures. The original label was 'K512R/K520R/K521R/K529R'. Wed May 02 16:29:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys512arg,lys520arg,lys521arg,lys529arg' Tue Jun 30 16:40:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys512Arg;Lys520Arg;Lys521Arg;Lys529Arg]' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association hopab2-pto-1 1 6 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 7 unspecified role unspecified role bait bait Region 1-307 Region 1-307 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association