DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The structure of Lethocerus troponin C: insights into the mechanism of stretch activation in muscles. The structure of Lethocerus troponin C: insights into the mechanism of stretch activation in muscles. Structure (London, England : 1993) 2007 imex curation De Nicola G., Burkart C., Qiu F., Agianian B., Labeit S., Martin S., Bullard B., Pastore A. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined De Nicola G., Burkart C., Qiu F., Agianian B., Labeit S., Martin S., Bullard B., Pastore A. DIP original experiment: DIP-67815X Structure (London, England : 1993) 2007 IMEx The structure of Lethocerus troponin C: insights into the mechanism of stretch activation in muscles. The structure of Lethocerus troponin C: insights into the mechanism of stretch activation in muscles. The structure of Lethocerus troponin C: insights into the mechanism of stretch activation in muscles. Structure (London, England : 1993) 2007 imex curation De Nicola G., Burkart C., Qiu F., Agianian B., Labeit S., Martin S., Bullard B., Pastore A. Only protein-protein interactions in vitro In vitro cd circular dichroism CD CD cd predetermined predetermined participant predetermined De Nicola G., Burkart C., Qiu F., Agianian B., Labeit S., Martin S., Bullard B., Pastore A. DIP original experiment: DIP-67811X Structure (London, England : 1993) 2007 IMEx The structure of Lethocerus troponin C: insights into the mechanism of stretch activation in muscles. The structure of Lethocerus troponin C: insights into the mechanism of stretch activation in muscles. The structure of Lethocerus troponin C: insights into the mechanism of stretch activation in muscles. Structure (London, England : 1993) 2007 imex curation De Nicola G., Burkart C., Qiu F., Agianian B., Labeit S., Martin S., Bullard B., Pastore A. Only protein-protein interactions in vitro In vitro comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel predetermined predetermined participant predetermined De Nicola G., Burkart C., Qiu F., Agianian B., Labeit S., Martin S., Bullard B., Pastore A. DIP original experiment: DIP-67813X Structure (London, England : 1993) 2007 IMEx The structure of Lethocerus troponin C: insights into the mechanism of stretch activation in muscles. The structure of Lethocerus troponin C: insights into the mechanism of stretch activation in muscles. The structure of Lethocerus troponin C: insights into the mechanism of stretch activation in muscles. Structure (London, England : 1993) 2007 imex curation De Nicola G., Burkart C., Qiu F., Agianian B., Labeit S., Martin S., Bullard B., Pastore A. Only protein-protein interactions in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined De Nicola G., Burkart C., Qiu F., Agianian B., Labeit S., Martin S., Bullard B., Pastore A. DIP original experiment: DIP-67814X Structure (London, England : 1993) 2007 IMEx The structure of Lethocerus troponin C: insights into the mechanism of stretch activation in muscles. The structure of Lethocerus troponin C: insights into the mechanism of stretch activation in muscles. The structure of Lethocerus troponin C: insights into the mechanism of stretch activation in muscles. Structure (London, England : 1993) 2007 imex curation De Nicola G., Burkart C., Qiu F., Agianian B., Labeit S., Martin S., Bullard B., Pastore A. Only protein-protein interactions in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined De Nicola G., Burkart C., Qiu F., Agianian B., Labeit S., Martin S., Bullard B., Pastore A. DIP original experiment: DIP-67812X Structure (London, England : 1993) 2007 IMEx The structure of Lethocerus troponin C: insights into the mechanism of stretch activation in muscles. q868d4_9hemi tnC4 protein protein Lethocerus indicus Lethocerus indicus MGDVSKLSSNQVKLLETAFRDFETPEGSGRVSTDQIGIILEVLGIQQTKSTIRQLIDEFDPFGNGDIDFDSFKIIGARFLGEEVNPEQMQQELREAFRLYDKEGNGYISTDVMREILAELDETLSSEDLDAMIDEIDADGSGTVDFEEFMGVMTGGDE DIP protein Q868D4 original sequence version: 22 q704p7_9hemi tnI1 protein protein Lethocerus indicus Lethocerus indicus MADEEAKKAKQAEIERKRAEVRKRMEEASKAKKAKKGFMTPERKKKLRLLLRKKAAEELKKEQERKAAERRRIIEERCGHCCDVDNANEDDLHEVIQHYYDRMYTCESQKWDLEYEVRKRDLEISDLNSQVNDLRGKFVKPTLKKVSKYENKFAKLQKKAAEFNFRNQLKVVKKKEFTMEEEEKEKKVVDWSKKDEKKVDEEAVVNSDVAELSSVQESVSQEAPPVDTQSEASEIPTTTTQEEHKQEEQQQQQQPPPPPKTEDDLWLFLKEAITSANPMTLEELQQKLIDTVSHVPPDFLEPVVEASIKRSQSMDQLASISSEVAEGGPPAEPGKEGEAAPPAEGAPAAAPPAEGAPPAEGTPAAAAPPAEGAPAAAAPPAEGAPPAEGAAPAAAPPAEGAPAAAAPPAEGAPAAAAPPAEGAQAAAAPPAEGAPAAGAPPAEGAPPAAAAPPAEGAAPPAEGAAAPAPAIQPVDAPPQVQAAA DIP protein Q704P7 original sequence version: 13 tnc4-tni1-1 1 7 unspecified role unspecified role prey prey Binding region 1-76 Binding region 1-76 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 6 unspecified role unspecified role bait bait Binding region 81-158 Binding region 81-158 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction tnc4-tni1-2 2 7 unspecified role unspecified role unspecified role unspecified role Region 30-61 Region 30-61 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Region 126-159 Region 126-159 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction tnc4-tni1-3 3 7 unspecified role unspecified role unspecified role unspecified role Region 30-61 Region 30-61 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction tnc4-tni1-4 4 7 unspecified role unspecified role unspecified role unspecified role Region 1-224 Region 1-224 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction tnc4-tni1-5 5 7 unspecified role unspecified role unspecified role unspecified role Region 30-61 Region 30-61 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Region 126-159 Region 126-159 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction