DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Bak regulates mitochondrial morphology and pathology during apoptosis by interacting with mitofusins. Bak regulates mitochondrial morphology and pathology during apoptosis by interacting with mitofusins. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Brooks C., Wei Q., Feng L., Dong G., Tao Y., Mei L., Xie ZJ., Dong Z. Only protein-protein interactions mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Brooks C., Wei Q., Feng L., Dong G., Tao Y., Mei L., Xie ZJ., Dong Z. DIP original experiment: DIP-261744X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Bak regulates mitochondrial morphology and pathology during apoptosis by interacting with mitofusins. Bak regulates mitochondrial morphology and pathology during apoptosis by interacting with mitofusins. Bak regulates mitochondrial morphology and pathology during apoptosis by interacting with mitofusins. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Brooks C., Wei Q., Feng L., Dong G., Tao Y., Mei L., Xie ZJ., Dong Z. Only protein-protein interactions mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Brooks C., Wei Q., Feng L., Dong G., Tao Y., Mei L., Xie ZJ., Dong Z. DIP original experiment: DIP-261743X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Bak regulates mitochondrial morphology and pathology during apoptosis by interacting with mitofusins. Bak regulates mitochondrial morphology and pathology during apoptosis by interacting with mitofusins. Bak regulates mitochondrial morphology and pathology during apoptosis by interacting with mitofusins. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Brooks C., Wei Q., Feng L., Dong G., Tao Y., Mei L., Xie ZJ., Dong Z. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Brooks C., Wei Q., Feng L., Dong G., Tao Y., Mei L., Xie ZJ., Dong Z. DIP original experiment: DIP-261739X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Bak regulates mitochondrial morphology and pathology during apoptosis by interacting with mitofusins. Bak regulates mitochondrial morphology and pathology during apoptosis by interacting with mitofusins. Bak regulates mitochondrial morphology and pathology during apoptosis by interacting with mitofusins. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Brooks C., Wei Q., Feng L., Dong G., Tao Y., Mei L., Xie ZJ., Dong Z. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Brooks C., Wei Q., Feng L., Dong G., Tao Y., Mei L., Xie ZJ., Dong Z. DIP original experiment: DIP-261741X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Bak regulates mitochondrial morphology and pathology during apoptosis by interacting with mitofusins. Bak regulates mitochondrial morphology and pathology during apoptosis by interacting with mitofusins. Bak regulates mitochondrial morphology and pathology during apoptosis by interacting with mitofusins. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Brooks C., Wei Q., Feng L., Dong G., Tao Y., Mei L., Xie ZJ., Dong Z. Only protein-protein interactions human Homo sapiens Human fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Brooks C., Wei Q., Feng L., Dong G., Tao Y., Mei L., Xie ZJ., Dong Z. DIP original experiment: DIP-261748X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Bak regulates mitochondrial morphology and pathology during apoptosis by interacting with mitofusins. Bak regulates mitochondrial morphology and pathology during apoptosis by interacting with mitofusins. Bak regulates mitochondrial morphology and pathology during apoptosis by interacting with mitofusins. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Brooks C., Wei Q., Feng L., Dong G., Tao Y., Mei L., Xie ZJ., Dong Z. Only protein-protein interactions human Homo sapiens Human fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Brooks C., Wei Q., Feng L., Dong G., Tao Y., Mei L., Xie ZJ., Dong Z. DIP original experiment: DIP-261747X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Bak regulates mitochondrial morphology and pathology during apoptosis by interacting with mitofusins. Bak regulates mitochondrial morphology and pathology during apoptosis by interacting with mitofusins. Bak regulates mitochondrial morphology and pathology during apoptosis by interacting with mitofusins. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Brooks C., Wei Q., Feng L., Dong G., Tao Y., Mei L., Xie ZJ., Dong Z. Only protein-protein interactions mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Brooks C., Wei Q., Feng L., Dong G., Tao Y., Mei L., Xie ZJ., Dong Z. DIP original experiment: DIP-261742X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Bak regulates mitochondrial morphology and pathology during apoptosis by interacting with mitofusins. Bak regulates mitochondrial morphology and pathology during apoptosis by interacting with mitofusins. Bak regulates mitochondrial morphology and pathology during apoptosis by interacting with mitofusins. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Brooks C., Wei Q., Feng L., Dong G., Tao Y., Mei L., Xie ZJ., Dong Z. Only protein-protein interactions human Homo sapiens Human fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Brooks C., Wei Q., Feng L., Dong G., Tao Y., Mei L., Xie ZJ., Dong Z. DIP original experiment: DIP-261745X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Bak regulates mitochondrial morphology and pathology during apoptosis by interacting with mitofusins. Bak regulates mitochondrial morphology and pathology during apoptosis by interacting with mitofusins. Bak regulates mitochondrial morphology and pathology during apoptosis by interacting with mitofusins. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Brooks C., Wei Q., Feng L., Dong G., Tao Y., Mei L., Xie ZJ., Dong Z. Only protein-protein interactions human Homo sapiens Human fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Brooks C., Wei Q., Feng L., Dong G., Tao Y., Mei L., Xie ZJ., Dong Z. DIP original experiment: DIP-261746X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Bak regulates mitochondrial morphology and pathology during apoptosis by interacting with mitofusins. Bak regulates mitochondrial morphology and pathology during apoptosis by interacting with mitofusins. Bak regulates mitochondrial morphology and pathology during apoptosis by interacting with mitofusins. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Brooks C., Wei Q., Feng L., Dong G., Tao Y., Mei L., Xie ZJ., Dong Z. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Brooks C., Wei Q., Feng L., Dong G., Tao Y., Mei L., Xie ZJ., Dong Z. DIP original experiment: DIP-261740X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Bak regulates mitochondrial morphology and pathology during apoptosis by interacting with mitofusins. bak_mouse Bcl-2 homologous antagonist/killer Apoptosis regulator BAK Bak1 Bak protein protein mouse Mus musculus Mouse MASGQGPGPPKVGCDESPSPSEQQVAQDTEEVFRSYVFYLHQQEQETQGAAAPANPEMDNLPLEPNSILGQVGRQLALIGDDINRRYDTEFQNLLEQLQPTAGNAYELFTKIASSLFKSGISWGRVVALLGFGYRLALYVYQRGLTGFLGQVTCFLADIILHHYIARWIAQRGGWVAALNFRRDPILTVMVIFGVVLLGQFVVHRFFRS DIP protein O08734 original sequence version: 116 DIP protein O08734 original sequence version: 66 DIP protein O08734 original sequence version: 114 DIP protein O08734 original sequence version: 129 49972D3CA21F4218 mfn1_mouse Mitofusin-1 Mfn1 Transmembrane GTPase MFN1 protein protein mouse Mus musculus Mouse MAETVSPLKHFVLAKKAITAIFGQLLEFVTEGSHFVEATYRNPELDRIASEDDLVEIQGYRNKLAVIGEVLSRRHMKVAFFGRTSSGKSSVINAMLWDKVLPSGIGHTTNCFLSVEGTDGDKAYLMTEGSDEKKSVKTVNQLAHALHMDKDLKAGCLVHVFWPKAKCALLRDDLVLVDSPGTDVTTELDIWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWDASASEPEYMEDVRRQHMERCLHFLVEELKVVSPSEARNRIFFVSAKEVLNSRKHKAQGMPEGGGALAEGFQARLQEFQNFEQTFEECISQSAVKTKFEQHTIRAKQILDTVKNILDSVNVAAAEKRVYSMEEREDQIDRLDFIRNQMNLLTLDVKKKIKEVTEEVANKVSCAMTDEICRLSVLVDEFCSEFHPTPSVLKVYKSELNKHIEDGMGRNLADRCTNEVNASILQSQQEIIENLKPLLPAGIQNKLHTLIPCKKFDLSYDLNCHKLCSDFQEDIVFRFSLGWSSLVHRFLGSTNAQRVLLGLSEPIFQVPRSLASTPTAPSNPAAPDNAAQEELMITLITGLASLTSRTSMGIIVVGGVIWKTVGWKLISVTLSMYGALYLYERLTWTTRAKERAFKQQFVNYATEKLQMIVSFTSANCSHQVQQEMATTFARLCQQVDVTQKHLEEEIARLSKEIDQLEKIQNNSKLLRNKAVQLESELENFSKQFLHPSSGES DIP protein Q811U4 original sequence version: 98 36E5E90DB0C0D5A1 bak_human Bcl-2 homologous antagonist/killer Apoptosis regulator BAK Bcl-2-like protein 7 BAK1 BAK BCL2L7 CDN1 protein protein human Homo sapiens Human MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVLLGQFVVRRFFKS DIP protein Q16611 original sequence version: 74 DIP protein Q16611 original sequence version: 162 DIP protein Q16611 original sequence version: 97 DIP protein Q16611 original sequence version: 158 DIP protein Q16611 original sequence version: 151 DIP protein Q16611-1 original sequence version: 178 DIP protein Q16611-1 original sequence version: 180 DIP protein Q16611 original sequence version: 121 A2200FE72A46D04E mfn1_human Mitofusin-1 Transmembrane GTPase MFN1 Fzo homolog MFN1 protein protein human Homo sapiens Human MAEPVSPLKHFVLAKKAITAIFDQLLEFVTEGSHFVEATYKNPELDRIATEDDLVEMQGYKDKLSIIGEVLSRRHMKVAFFGRTSSGKSSVINAMLWDKVLPSGIGHITNCFLSVEGTDGDKAYLMTEGSDEKKSVKTVNQLAHALHMDKDLKAGCLVRVFWPKAKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWDASASEPEYMEDVRRQHMERCLHFLVEELKVVNALEAQNRIFFVSAKEVLSARKQKAQGMPESGVALAEGFHARLQEFQNFEQIFEECISQSAVKTKFEQHTIRAKQILATVKNIMDSVNLAAEDKRHYSVEEREDQIDRLDFIRNQMNLLTLDVKKKIKEVTEEVANKVSCAMTDEICRLSVLVDEFCSEFHPNPDVLKIYKSELNKHIEDGMGRNLADRCTDEVNALVLQTQQEIIENLKPLLPAGIQDKLHTLIPCKKFDLSYNLNYHKLCSDFQEDIVFRFSLGWSSLVHRFLGPRNAQRVLLGLSEPIFQLPRSLASTPTAPTTPATPDNASQEELMITLVTGLASVTSRTSMGIIIVGGVIWKTIGWKLLSVSLTMYGALYLYERLSWTTHAKERAFKQQFVNYATEKLRMIVSSTSANCSHQVKQQIATTFARLCQQVDITQKQLEEEIARLPKEIDQLEKIQNNSKLLRNKAVQLENELENFTKQFLPSSNEES DIP protein Q8IWA4 original sequence version: 106 DIP protein Q8IWA4-1 original sequence version: 52 B7BDC22437E30A58 mfn2_mouse Mitofusin-2 Mfn2 Kiaa0214 Marf Hypertension-related protein 1 Mitochondrial assembly regulatory factor Transmembrane GTPase MFN2 protein protein mouse Mus musculus Mouse MSLLFSRCNSIVTVKKDKRHMAEVNASPLKHFVTAKKKINGIFEQLGAYIQESASFLEDTHRNTELDPVTTEEQVLDVKGYLSKVRGISEVLARRHMKVAFFGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVGGTDGHEAFLLTEGSEEKKSVKTVNQLAHALHQDEQLHAGSMVSVMWPNSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKQFFHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHMERCTSFLVDELGVVDRAQAGDRIFFVSAKEVLSARVQKAQGMPEGGGALAEGFQVRMFEFQNFERQFEECISQSAVKTKFEQHTVRAKQIAEAVRLIMDSLHIAAQEQRVYCLEMREERQDRLRFIDKQLELLAQDYKLRIKQITEEVERQVSTAMAEEIRRLSVLVDEYQMDFHPSPVVLKVYKNELHRHIEEGLGRNLSDRCSTAIASSLQTMQQDMIDGLKPLLPVSMRNQIDMLVPRQCFSLSYDLNCDKLCADFQEDIEFHFSLGWTMLVNRFLGPKNSRRALLGYSDQVQRPLPLTPANPSMPPLPQSSLTQEELMVSMVTGLASLTSRTSMGILVVGGVVWKAVGWRLIALSFGLYGLLYVYERLTWTTKAKERAFKRQFVEYASEKLQLIISYTGSNCSHQVQQELSGTFAHLCQQVDITRDNLEQEIAAMNKKVEALDSLQSRAKLLRNKAGWLDSELNMFTHQYLQPSR DIP protein Q80U63 original sequence version: 100 DIP protein Q80U63 original sequence version: 110 mint 25B0EAE8301F4D1A bax_human Apoptosis regulator BAX BAX BCL2L4 Bcl-2-like protein 4 protein protein human Homo sapiens Human MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG DIP protein Q07812 original sequence version: 73 DIP protein Q07812 original sequence version: 156 DIP protein Q07812 original sequence version: 92 DIP protein Q07812 original sequence version: 94 DIP protein Q07812-1 original sequence version: 93 DIP protein Q07812 original sequence version: 95 DIP protein Q07812 original sequence version: 120 DIP protein Q07812 original sequence version: 126 DIP protein Q07812 original sequence version: 143 DIP protein Q07812 original sequence version: 172 DIP protein Q07812 original sequence version: 175 6C0CDB0A7DEE4994 mfn2_human Mitofusin-2 MFN2 CPRP1 KIAA0214 Transmembrane GTPase MFN2 protein protein human Homo sapiens Human MSLLFSRCNSIVTVKKNKRHMAEVNASPLKHFVTAKKKINGIFEQLGAYIQESATFLEDTYRNAELDPVTTEEQVLDVKGYLSKVRGISEVLARRHMKVAFFGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVEGTDGHEAFLLTEGSEEKRSAKTVNQLAHALHQDKQLHAGSLVSVMWPNSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKHFFHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHMERCTSFLVDELGVVDRSQAGDRIFFVSAKEVLNARIQKAQGMPEGGGALAEGFQVRMFEFQNFERRFEECISQSAVKTKFEQHTVRAKQIAEAVRLIMDSLHMAAREQQVYCEEMREERQDRLKFIDKQLELLAQDYKLRIKQITEEVERQVSTAMAEEIRRLSVLVDDYQMDFHPSPVVLKVYKNELHRHIEEGLGRNMSDRCSTAITNSLQTMQQDMIDGLKPLLPVSVRSQIDMLVPRQCFSLNYDLNCDKLCADFQEDIEFHFSLGWTMLVNRFLGPKNSRRALMGYNDQVQRPIPLTPANPSMPPLPQGSLTQEEFMVSMVTGLASLTSRTSMGILVVGGVVWKAVGWRLIALSFGLYGLLYVYERLTWTTKAKERAFKRQFVEHASEKLQLVISYTGSNCSHQVQQELSGTFAHLCQQVDVTRENLEQEIAAMNKKIEVLDSLQSKAKLLRNKAGWLDSELNMFTHQYLQPSR DIP protein O95140 original sequence version: 125 DIP protein O95140-1 original sequence version: 67 DIP protein O95140 original sequence version: 136 6F859D740152DFAD mfn2-bak1-1 2 15 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range mouse Mus musculus Mouse 11 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association bak1-mfn1-2 3 17 unspecified role unspecified role prey prey human Homo sapiens Human 14 unspecified role unspecified role prey prey human Homo sapiens Human 13 unspecified role unspecified role bait bait human Homo sapiens Human association association mfn2-bak1-2 4 15 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 16 unspecified role unspecified role prey prey human Homo sapiens Human 13 unspecified role unspecified role prey prey human Homo sapiens Human association association bak1-mfn1-3 8 13 unspecified role unspecified role fluorescence donor fluorescence donor ECFP-tag ECFP-tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 12 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept EYFP-tag EYFP-tag eyfp enhanced yellow fluorescent protein tag eyfp n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human proximity proximity close-contact colocalization neighbourhood interaction bax-mfn1-1 6 16 unspecified role unspecified role fluorescence donor fluorescence donor ECFP-tag ECFP-tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 12 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept EYFP-tag EYFP-tag eyfp enhanced yellow fluorescent protein tag eyfp n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human proximity proximity close-contact colocalization neighbourhood interaction mfn1-bak1-1 10 12 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 13 unspecified role unspecified role prey prey human Homo sapiens Human 16 unspecified role unspecified role prey prey human Homo sapiens Human association association mfn1-bak1-2 7 11 unspecified role unspecified role prey prey mouse Mus musculus Mouse 12 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range mouse Mus musculus Mouse physical association physical association mfn2-bak1-3 1 15 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range mouse Mus musculus Mouse 13 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association bak1-mfn2-1 9 15 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept EYFP-tag EYFP-tag eyfp enhanced yellow fluorescent protein tag eyfp n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 13 unspecified role unspecified role fluorescence donor fluorescence donor ECFP-tag ECFP-tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human proximity proximity close-contact colocalization neighbourhood interaction bax-mfn2-1 5 15 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept EYFP-tag EYFP-tag eyfp enhanced yellow fluorescent protein tag eyfp n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 16 unspecified role unspecified role fluorescence donor fluorescence donor ECFP-tag ECFP-tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human proximity proximity close-contact colocalization neighbourhood interaction