DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Cellular prion protein regulates beta-secretase cleavage of the Alzheimer's amyloid precursor protein. Cellular prion protein regulates beta-secretase cleavage of the Alzheimer's amyloid precursor protein. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Parkin ET., Watt NT., Hussain I., Eckman EA., Eckman CB., Manson JC., Baybutt HN., Turner AJ., Hooper NM. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Parkin ET., Watt NT., Hussain I., Eckman EA., Eckman CB., Manson JC., Baybutt HN., Turner AJ., Hooper NM. DIP original experiment: DIP-261641X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Cellular prion protein regulates beta-secretase cleavage of the Alzheimer's amyloid precursor protein. prio_mouse Major prion protein PrP27-30 PrP33-35C Prnp Prn-p Prp protein protein mouse Mus musculus Mouse MANLGYWLLALFVTMWTDVGLCKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGTWGQPHGGGWGQPHGGSWGQPHGGSWGQPHGGGWGQGGGTHNQWNKPSKPKTNLKHVAGAAAAGAVVGGLGGYMLGSAMSRPMIHFGNDWEDRYYRENMYRYPNQVYYRPVDQYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCVTQYQKESQAYYDGRRSSSTVLFSSPPVILLISFLIFLIVG DIP protein P04925 original sequence version: 157 DIP protein P04925 original sequence version: 140 DIP protein P04925 original sequence version: 122 DIP protein P04925 original sequence version: 117 DIP protein P04925 original sequence version: 132 DIP protein P04925 original sequence version: 128 D5331E6321826CC0 bace1_human Beta-secretase 1 BACE KIAA1149 Beta-site amyloid precursor protein cleaving enzyme 1 Membrane-associated aspartic protease 2 Memapsin-2 Aspartyl protease 2 BACE1 protein protein human Homo sapiens Human MAQALPWLLLWMGAGVLPAHGTQHGIRLPLRSGLGGAPLGLRLPRETDEEPEEPGRRGSFVEMVDNLRGKSGQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTYRDLRKGVYVPYTQGKWEGELGTDLVSIPHGPNVTVRANIAAITESDKFFINGSNWEGILGLAYAEIARPDDSLEPFFDSLVKQTHVPNLFSLQLCGAGFPLNQSEVLASVGGSMIIGGIDHSLYTGSLWYTPIRREWYYEVIIVRVEINGQDLKMDCKEYNYDKSIVDSGTTNLRLPKKVFEAAVKSIKAASSTEKFPDGFWLGEQLVCWQAGTTPWNIFPVISLYLMGEVTNQSFRITILPQQYLRPVEDVATSQDDCYKFAISQSSTGTVMGAVIMEGFYVVFDRARKRIGFAVSACHVHDEFRTAAVEGPFVTLDMEDCGYNIPQTDESTLMTIAYVMAAICALFMLPLCLMVCQWRCLRCLRQQHDDFADDISLLK DIP protein P56817 original sequence version: 161 377CE4C824ACEF05 377CE4C824ACEF05 prnp-bace1-1 1 3 unspecified role unspecified role prey prey human Homo sapiens Human 2 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association