DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Exploitation of structural and regulatory diversity in glutamate racemases. Exploitation of structural and regulatory diversity in glutamate racemases. Nature 2007 imex curation Lundqvist T., Fisher SL., Kern G., Folmer RH., Xue Y., Newton DT., Keating TA., Alm RA., de Jonge BL. Only protein-protein interactions ecolx Escherichia coli light scattering light scattering predetermined predetermined participant predetermined Lundqvist T., Fisher SL., Kern G., Folmer RH., Xue Y., Newton DT., Keating TA., Alm RA., de Jonge BL. DIP original experiment: DIP-253335X Nature 2007 IMEx Exploitation of structural and regulatory diversity in glutamate racemases. Exploitation of structural and regulatory diversity in glutamate racemases. Exploitation of structural and regulatory diversity in glutamate racemases. Nature 2007 imex curation Lundqvist T., Fisher SL., Kern G., Folmer RH., Xue Y., Newton DT., Keating TA., Alm RA., de Jonge BL. Only protein-protein interactions ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Lundqvist T., Fisher SL., Kern G., Folmer RH., Xue Y., Newton DT., Keating TA., Alm RA., de Jonge BL. DIP original experiment: DIP-253322X Nature 2007 IMEx Exploitation of structural and regulatory diversity in glutamate racemases. Exploitation of structural and regulatory diversity in glutamate racemases. Exploitation of structural and regulatory diversity in glutamate racemases. Nature 2007 imex curation Lundqvist T., Fisher SL., Kern G., Folmer RH., Xue Y., Newton DT., Keating TA., Alm RA., de Jonge BL. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Lundqvist T., Fisher SL., Kern G., Folmer RH., Xue Y., Newton DT., Keating TA., Alm RA., de Jonge BL. DIP original experiment: DIP-253333X Nature 2007 IMEx Exploitation of structural and regulatory diversity in glutamate racemases. Exploitation of structural and regulatory diversity in glutamate racemases. Exploitation of structural and regulatory diversity in glutamate racemases. Nature 2007 imex curation Lundqvist T., Fisher SL., Kern G., Folmer RH., Xue Y., Newton DT., Keating TA., Alm RA., de Jonge BL. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Lundqvist T., Fisher SL., Kern G., Folmer RH., Xue Y., Newton DT., Keating TA., Alm RA., de Jonge BL. DIP original experiment: DIP-253324X Nature 2007 IMEx Exploitation of structural and regulatory diversity in glutamate racemases. Exploitation of structural and regulatory diversity in glutamate racemases. Exploitation of structural and regulatory diversity in glutamate racemases. Nature 2007 imex curation Lundqvist T., Fisher SL., Kern G., Folmer RH., Xue Y., Newton DT., Keating TA., Alm RA., de Jonge BL. Only protein-protein interactions ecolx Escherichia coli light scattering light scattering predetermined predetermined participant predetermined Lundqvist T., Fisher SL., Kern G., Folmer RH., Xue Y., Newton DT., Keating TA., Alm RA., de Jonge BL. DIP original experiment: DIP-253323X Nature 2007 IMEx Exploitation of structural and regulatory diversity in glutamate racemases. Exploitation of structural and regulatory diversity in glutamate racemases. Exploitation of structural and regulatory diversity in glutamate racemases. Nature 2007 imex curation Lundqvist T., Fisher SL., Kern G., Folmer RH., Xue Y., Newton DT., Keating TA., Alm RA., de Jonge BL. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Lundqvist T., Fisher SL., Kern G., Folmer RH., Xue Y., Newton DT., Keating TA., Alm RA., de Jonge BL. DIP original experiment: DIP-253329X Nature 2007 IMEx Exploitation of structural and regulatory diversity in glutamate racemases. Exploitation of structural and regulatory diversity in glutamate racemases. Exploitation of structural and regulatory diversity in glutamate racemases. Nature 2007 imex curation Lundqvist T., Fisher SL., Kern G., Folmer RH., Xue Y., Newton DT., Keating TA., Alm RA., de Jonge BL. Only protein-protein interactions ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Lundqvist T., Fisher SL., Kern G., Folmer RH., Xue Y., Newton DT., Keating TA., Alm RA., de Jonge BL. DIP original experiment: DIP-253330X Nature 2007 IMEx Exploitation of structural and regulatory diversity in glutamate racemases. Exploitation of structural and regulatory diversity in glutamate racemases. Exploitation of structural and regulatory diversity in glutamate racemases. Nature 2007 imex curation Lundqvist T., Fisher SL., Kern G., Folmer RH., Xue Y., Newton DT., Keating TA., Alm RA., de Jonge BL. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Lundqvist T., Fisher SL., Kern G., Folmer RH., Xue Y., Newton DT., Keating TA., Alm RA., de Jonge BL. DIP original experiment: DIP-253332X Nature 2007 IMEx Exploitation of structural and regulatory diversity in glutamate racemases. Exploitation of structural and regulatory diversity in glutamate racemases. Exploitation of structural and regulatory diversity in glutamate racemases. Nature 2007 imex curation Lundqvist T., Fisher SL., Kern G., Folmer RH., Xue Y., Newton DT., Keating TA., Alm RA., de Jonge BL. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Lundqvist T., Fisher SL., Kern G., Folmer RH., Xue Y., Newton DT., Keating TA., Alm RA., de Jonge BL. DIP original experiment: DIP-253321X Nature 2007 IMEx Exploitation of structural and regulatory diversity in glutamate racemases. Exploitation of structural and regulatory diversity in glutamate racemases. Exploitation of structural and regulatory diversity in glutamate racemases. Nature 2007 imex curation Lundqvist T., Fisher SL., Kern G., Folmer RH., Xue Y., Newton DT., Keating TA., Alm RA., de Jonge BL. Only protein-protein interactions ecolx Escherichia coli light scattering light scattering predetermined predetermined participant predetermined Lundqvist T., Fisher SL., Kern G., Folmer RH., Xue Y., Newton DT., Keating TA., Alm RA., de Jonge BL. DIP original experiment: DIP-253327X Nature 2007 IMEx Exploitation of structural and regulatory diversity in glutamate racemases. Exploitation of structural and regulatory diversity in glutamate racemases. Exploitation of structural and regulatory diversity in glutamate racemases. Nature 2007 imex curation Lundqvist T., Fisher SL., Kern G., Folmer RH., Xue Y., Newton DT., Keating TA., Alm RA., de Jonge BL. Only protein-protein interactions ecolx Escherichia coli light scattering light scattering predetermined predetermined participant predetermined Lundqvist T., Fisher SL., Kern G., Folmer RH., Xue Y., Newton DT., Keating TA., Alm RA., de Jonge BL. DIP original experiment: DIP-253331X Nature 2007 IMEx Exploitation of structural and regulatory diversity in glutamate racemases. Exploitation of structural and regulatory diversity in glutamate racemases. Exploitation of structural and regulatory diversity in glutamate racemases. Nature 2007 imex curation Lundqvist T., Fisher SL., Kern G., Folmer RH., Xue Y., Newton DT., Keating TA., Alm RA., de Jonge BL. Only protein-protein interactions ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Lundqvist T., Fisher SL., Kern G., Folmer RH., Xue Y., Newton DT., Keating TA., Alm RA., de Jonge BL. DIP original experiment: DIP-253326X Nature 2007 IMEx Exploitation of structural and regulatory diversity in glutamate racemases. Exploitation of structural and regulatory diversity in glutamate racemases. Exploitation of structural and regulatory diversity in glutamate racemases. Nature 2007 imex curation Lundqvist T., Fisher SL., Kern G., Folmer RH., Xue Y., Newton DT., Keating TA., Alm RA., de Jonge BL. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Lundqvist T., Fisher SL., Kern G., Folmer RH., Xue Y., Newton DT., Keating TA., Alm RA., de Jonge BL. DIP original experiment: DIP-253328X Nature 2007 IMEx Exploitation of structural and regulatory diversity in glutamate racemases. Exploitation of structural and regulatory diversity in glutamate racemases. Exploitation of structural and regulatory diversity in glutamate racemases. Nature 2007 imex curation Lundqvist T., Fisher SL., Kern G., Folmer RH., Xue Y., Newton DT., Keating TA., Alm RA., de Jonge BL. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Lundqvist T., Fisher SL., Kern G., Folmer RH., Xue Y., Newton DT., Keating TA., Alm RA., de Jonge BL. DIP original experiment: DIP-253336X Nature 2007 IMEx Exploitation of structural and regulatory diversity in glutamate racemases. Exploitation of structural and regulatory diversity in glutamate racemases. Exploitation of structural and regulatory diversity in glutamate racemases. Nature 2007 imex curation Lundqvist T., Fisher SL., Kern G., Folmer RH., Xue Y., Newton DT., Keating TA., Alm RA., de Jonge BL. Only protein-protein interactions ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Lundqvist T., Fisher SL., Kern G., Folmer RH., Xue Y., Newton DT., Keating TA., Alm RA., de Jonge BL. DIP original experiment: DIP-253334X Nature 2007 IMEx Exploitation of structural and regulatory diversity in glutamate racemases. Exploitation of structural and regulatory diversity in glutamate racemases. Exploitation of structural and regulatory diversity in glutamate racemases. Nature 2007 imex curation Lundqvist T., Fisher SL., Kern G., Folmer RH., Xue Y., Newton DT., Keating TA., Alm RA., de Jonge BL. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Lundqvist T., Fisher SL., Kern G., Folmer RH., Xue Y., Newton DT., Keating TA., Alm RA., de Jonge BL. DIP original experiment: DIP-253325X Nature 2007 IMEx Exploitation of structural and regulatory diversity in glutamate racemases. muri_helpj Glutamate racemase murI glr jhp_0496 protein protein helpj Helicobacter pylori J99 Campylobacter pylori J99 MKIGVFDSGVGGFSVLKSLLKARLFDEIIYYGDSARVPYGTKDPTTIKQFGLEALDFFKPHEIELLIVACNTASALALEEMQKYSKIPIVGVIEPSILAIKRQVEDKNAPILVLGTKATIQSNAYDNALKQQGYLNISHLATSLFVPLIEESILEGELLETCMHYYFTPLEILPEVIILGCTHFPLIAQKIEGYFMGHFALPTPPLLIHSGDAIVEYLQQKYALKNNACTFPKVEFHASGDVIWLERQAKEWLKL DIP protein Q9ZLT0 original sequence version: 87 muri_staar Glutamate racemase murI SAR1123 protein protein strain mrsa252 Staphylococcus aureus MNKPIGVIDSGVGGLTVAKEIMRQLPNETIYYLGDIGRCPYGPRPGEQVKQYTVEIARKLMEFDIKMLVIACNTATAVALEYLQKTLSIPVIGVIEPGARTAIMTTRNQNVLVLGTEGTIKSEAYRTHIKRINPHVEVHGVACPGFVPLVEQMRYSDPTITSIVIHQTLKRWRNSESDTVILGCTHYPLLYKPIYDYFGGKKTVISSGLETAREVSALLTFSNEHASYTEHPDHRFFATGDTTHITNIIKEWLNLSVNVERISVND DIP protein Q6GHT5 original sequence version: 61 muri_entfa Glutamate racemase murI EF_1121 protein protein entfa Enterococcus faecalis (strain ATCC 700802 / V583) MSNQEAIGLIDSGVGGLTVLKEALKQLPNERLIYLGDTARCPYGPRPAEQVVQFTWEMADFLLKKRIKMLVIACNTATAVALEEIKAALPIPVVGVILPGARAAVKVTKNNKIGVIGTLGTIKSASYEIAIKSKAPTIEVTSLDCPKFVPIVESNQYRSSVAKKIVAETLQALQLKGLDTLILGCTHYPLLRPVIQNVMGSHVTLIDSGAETVGEVSMLLDYFDIAHTPEAPTQPHEFYTTGSAKMFEEIASSWLGIENLKAQQIHLGGNEND DIP protein Q836J0 original sequence version: 67 q3xzw8_entfd Glutamate racemase murI HMPREF0351_11289 protein protein Enterococcus faecium DO Enterococcus faecium DO MKKRMIRLTDNRPIGFIDSGVGGLTVVKEALKQLPNENILFVGDTARCPYGPRPAEQVIQYTWEMTDYLVEQGIKMLVIACNTATAVALEEIKAALSIPVIGVILPGTRAAVKKTQNKQVGIIGTIGTVKSQAYEKALKEKVPELTVTSLACPKFVSVVESNEYHSSVAKKIVAETLAPLTTKKIDTLILGCTHYPLLRPIIQNVMGENVQLIDSGAETVGEVSMLLDYFNLSNSPQNGRTLCQFYTTGSAKLFEEIAEDWLGIGHLNVEHIELGGK DIP protein Q3XZW8 original sequence version: 50 muri-1 9 17 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction muri-2 6 20 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction muri-3 2 17 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction muri-4 7 20 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction muri-5 5 17 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction muri-6 11 20 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction muri-7 4 17 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction muri-8 8 20 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction muri-9 16 19 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction muri-10 3 18 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction muri-11 12 19 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction muri-12 15 18 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction muri-13 10 19 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction muri-14 1 18 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction muri-15 13 19 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction muri-16 14 18 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction