DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structure-based discovery of an inhibitor of Arf activation by Sec7 domains through targeting of protein-protein complexes. Structure-based discovery of an inhibitor of Arf activation by Sec7 domains through targeting of protein-protein complexes. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Viaud J., Zeghouf M., Barelli H., Zeeh JC., Padilla A., Guibert B., Chardin P., Royer CA., Cherfils J., Chavanieu A. Only protein-protein interactions in vitro In vitro fluorescence spectr classical fluorescence spectroscopy fluorescence spectr predetermined predetermined participant predetermined Viaud J., Zeghouf M., Barelli H., Zeeh JC., Padilla A., Guibert B., Chardin P., Royer CA., Cherfils J., Chavanieu A. DIP original experiment: DIP-261627X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structure-based discovery of an inhibitor of Arf activation by Sec7 domains through targeting of protein-protein complexes. arf1_human ADP-ribosylation factor 1 ARF1 protein protein human Homo sapiens Human MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK DIP protein P84077 original sequence version: 122 DIP protein P84077 original sequence version: 56 DIP protein P84077 original sequence version: 89 AAC773D4A60186B6 cyh2_human Cytohesin-2 PH, SEC7 and coiled-coil domain-containing protein 2 ARF nucleotide-binding site opener ARF exchange factor CYTH2 ARNO PSCD2L PSCD2 protein protein human Homo sapiens Human MEDGVYEPPDLTPEERMELENIRRRKQELLVEIQRLREELSEAMSEVEGLEANEGSKTLQRNRKMAMGRKKFNMDPKKGIQFLVENELLQNTPEEIARFLYKGEGLNKTAIGDYLGEREELNLAVLHAFVDLHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCLCNPGVFQSTDTCYVLSFAVIMLNTSLHNPNVRDKPGLERFVAMNRGINEGGDLPEELLRNLYDSIRNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVDDPRKPNCFELYIPNNKGQLIKACKTEADGRVVEGNHMVYRISAPTQEEKDEWIKSIQAAVSVDPFYEMLAARKKRISVKKKQEQP DIP protein Q99418 original sequence version: 131 DIP protein Q99418 original sequence version: 140 DIP protein Q99418-1 original sequence version: 125 DIP protein Q99418 original sequence version: 125 70441A58483BD0E1 arf1-cyth2-1 1 3 unspecified role unspecified role unspecified role unspecified role Region 72-201 Region 72-201 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 2 unspecified role unspecified role unspecified role unspecified role Alexa488-label Alexa488-label alexa 488 label alexa 488 label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli direct interaction direct interaction