DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Trans-SNARE complex assembly and yeast vacuole membrane fusion. Trans-SNARE complex assembly and yeast vacuole membrane fusion. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Collins KM., Wickner WT. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Collins KM., Wickner WT. DIP original experiment: DIP-261483X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Trans-SNARE complex assembly and yeast vacuole membrane fusion. Trans-SNARE complex assembly and yeast vacuole membrane fusion. Trans-SNARE complex assembly and yeast vacuole membrane fusion. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Collins KM., Wickner WT. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Collins KM., Wickner WT. DIP original experiment: DIP-261484X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Trans-SNARE complex assembly and yeast vacuole membrane fusion. vti1_yeast t-SNARE VTI1 VTI1 Qb-SNARE VTI1 Vesicle transport v-SNARE protein VTI1 VPS10-interacting protein 1 YM9646.10C YMR197C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSLLISYESDFKTTLEQAKASLAEAPSQPLSQRNTTLKHVEQQQDELFDLLDQMDVEVNNSIGDASERATYKAKLREWKKTIQSDIKRPLQSLVDSGDRDRLFGDLNASNIDDDQRQQLLSNHAILQKSGDRLKDASRIANETEGIGSQIMMDLRSQRETLENARQTLFQADSYVDKSIKTLKTMTRRLVANKFISYAIIAVLILLILLVLFSKFK E55B4DA3B40FAD67 E55B4DA3B40FAD67 vam7_yeast Vacuolar morphogenesis protein 7 VAM7 YGL212W protein protein yeast Saccharomyces cerevisiae Baker's yeast MAANSVGKMSEKLRIKVDDVKINPKYVLYGVSTPNKRLYKRYSEFWKLKTRLERDVGSTIPYDFPEKPGVLDRRWQRRYDDPEMIDERRIGLERFLNELYNDRFDSRWRDTKIAQDFLQLSKPNVSQEKSQQHLETADEVGWDEMIRDIKLDLDKESDGTPSVRGALRARTKLHKLRERLEQDVQKKSLPSTEVTRRAALLRSLLKECDDIGTANIAQDRGRLLGVATSDNSSTTEVQGRTNNDLQQGQMQMVRDQEQELVALHRIIQAQRGLALEMNEELQTQNELLTALEDDVDNTGRRLQIANKKARHFNNSA 2F992AEC0ACBC8FE 2F992AEC0ACBC8FE vam3_yeast Syntaxin VAM3 VAM3 PTH1 YOR106W YOR3220W Vacuolar morphogenesis protein 3 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSFFDIEAQSSKGNSQQEPQFSTNQKTKELSNLIETFAEQSRVLEKECTKIGSKRDSKELRYKIETELIPNCTSVRDKIESNILIHQNGKLSADFKNLKTKYQSLQQSYNQRKSLFPLKTPISPGTSKERKDIHPRTEAVRQDPESSYISIKVNEQSPLLHNEGQHQLQLQEEQEQQQQGLSQEELDFQTIIHQERSQQIGRIHTAVQEVNAIFHQLGSLVKEQGEQVTTIDENISHLHDNMQNANKQLTRADQHQRDRNKCGKVTLIIIIVVCMVVLLAVLS 6415D9D852C6C64D 6415D9D852C6C64D nyv1_yeast Vacuolar v-SNARE NYV1 NYV1 Synaptobrevin NYV1 New v-SNARE 1 MAM2 YLR093C protein protein yeast Saccharomyces cerevisiae Baker's yeast MKRFNVSYVEVIKNGETISSCFQPFQKNENYGTITSANEQITPVIFHNLIMDMVLPKVVPIKGNKVTKMSMNLIDGFDCFYSTDDHDPKTVYVCFTLVDMPKILPIRILSGLQEYESNATNELLSSHVGQILDSFHEELVEYRNQTLNSSGNGQSSNGNGQNTISDIGDATEDQIKDVIQIMNDNIDKFLERQERVSLLVDKTSQLNSSSNKFRRKAVNIKEIMWWQKVKNITLLTFTIILFVSAAFMFFYLW 494B587CF0F85997 494B587CF0F85997 vam3p-nyv1p-1 1 3 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 4 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 6 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 5 unspecified role unspecified role bait bait CBP-tag CBP-tag cam tag calmodulin binding protein tag cam tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association vam3p-vam7p-1 2 3 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 4 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 5 unspecified role unspecified role bait bait CBP-tag CBP-tag cam tag calmodulin binding protein tag cam tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association