DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Conserved region I of human coactivator TAF4 binds to a short hydrophobic motif present in transcriptional regulators. Conserved region I of human coactivator TAF4 binds to a short hydrophobic motif present in transcriptional regulators. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Wang X., Truckses DM., Takada S., Matsumura T., Tanese N., Jacobson RH. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Wang X., Truckses DM., Takada S., Matsumura T., Tanese N., Jacobson RH. DIP original experiment: DIP-261463X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Conserved region I of human coactivator TAF4 binds to a short hydrophobic motif present in transcriptional regulators. Conserved region I of human coactivator TAF4 binds to a short hydrophobic motif present in transcriptional regulators. Conserved region I of human coactivator TAF4 binds to a short hydrophobic motif present in transcriptional regulators. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Wang X., Truckses DM., Takada S., Matsumura T., Tanese N., Jacobson RH. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Wang X., Truckses DM., Takada S., Matsumura T., Tanese N., Jacobson RH. DIP original experiment: DIP-261461X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Conserved region I of human coactivator TAF4 binds to a short hydrophobic motif present in transcriptional regulators. Conserved region I of human coactivator TAF4 binds to a short hydrophobic motif present in transcriptional regulators. Conserved region I of human coactivator TAF4 binds to a short hydrophobic motif present in transcriptional regulators. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Wang X., Truckses DM., Takada S., Matsumura T., Tanese N., Jacobson RH. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Wang X., Truckses DM., Takada S., Matsumura T., Tanese N., Jacobson RH. DIP original experiment: DIP-261464X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Conserved region I of human coactivator TAF4 binds to a short hydrophobic motif present in transcriptional regulators. Conserved region I of human coactivator TAF4 binds to a short hydrophobic motif present in transcriptional regulators. Conserved region I of human coactivator TAF4 binds to a short hydrophobic motif present in transcriptional regulators. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Wang X., Truckses DM., Takada S., Matsumura T., Tanese N., Jacobson RH. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Wang X., Truckses DM., Takada S., Matsumura T., Tanese N., Jacobson RH. DIP original experiment: DIP-261465X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Conserved region I of human coactivator TAF4 binds to a short hydrophobic motif present in transcriptional regulators. Conserved region I of human coactivator TAF4 binds to a short hydrophobic motif present in transcriptional regulators. Conserved region I of human coactivator TAF4 binds to a short hydrophobic motif present in transcriptional regulators. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Wang X., Truckses DM., Takada S., Matsumura T., Tanese N., Jacobson RH. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Wang X., Truckses DM., Takada S., Matsumura T., Tanese N., Jacobson RH. DIP original experiment: DIP-261462X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Conserved region I of human coactivator TAF4 binds to a short hydrophobic motif present in transcriptional regulators. zhang_human CREB/ATF bZIP transcription factor Host cell factor-binding transcription factor Zhangfei CREBZF ZF protein protein human Homo sapiens Human MRHSLTKLLAASGSNSPTRSESPEPAATCSLPSDLTRAAAGEEETAAAGSPGRKQQFGDEGELEAGRGSRGGVAVRAPSPEEMEEEAIASLPGEETEDMDFLSGLELADLLDPRQPDWHLDPGLSSPGPLSSSGGGSDSGGLWRGDDDDEAAAAEMQRFSDLLQRLLNGIGGCSSSSDSGSAEKRRRKSPGGGGGGGSGNDNNQAATKSPRKAAAAAARLNRLKKKEYVMGLESRVRGLAAENQELRAENRELGKRVQALQEESRYLRAVLANETGLARLLSRLSGVGLRLTTSLFRDSPAGDHDYALPVGKQKQDLLEEDDSAGGVCLHVDKDKVSVEFCSACARKASSSLKM DIP protein Q9NS37 original sequence version: 104 BE3AC77203216155 creb3_human Cyclic AMP-responsive element-binding protein 3 Luman Transcription factor LZIP-alpha CREB3 LZIP Leucine zipper protein protein protein human Homo sapiens Human MELELDAGDQDLLAFLLEESGDLGTAPDEAVRAPLDWALPLSEVPSDWEVDDLLCSLLSPPASLNILSSSNPCLVHHDHTYSLPRETVSMDLESESCRKEGTQMTPQHMEELAEQEIARLVLTDEEKSLLEKEGLILPETLPLTKTEEQILKRVRRKIRNKRSAQESRRKKKVYVGGLESRVLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIEISNKTSSSSTCILVLLVSFCLLLVPAMYSSDTRGSLPAEHGVLSRQLRALPSEDPYQLELPALQSEVPKDSTHQWLDGSDCVLQAPGNTSCLLHYMPQAPSAEPPLEWPFPDLFSEPLCRGPILPLQANLTRKGGWLPTGSPSVILQDRYSG DIP protein O43889 original sequence version: 133 82152E496B924EEC tfe2_human Transcription factor E2-alpha Immunoglobulin enhancer-binding factor E12/E47 Transcription factor 3 Immunoglobulin transcription factor 1 Transcription factor ITF-1 Kappa-E2-binding factor TCF3 E2A ITF1 BHLHB21 Class B basic helix-loop-helix protein 21 protein protein human Homo sapiens Human MNQPQRMAPVGTDKELSDLLDFSMMFPLPVTNGKGRPASLAGAQFGGSGLEDRPSSGSWGSGDQSSSSFDPSRTFSEGTHFTESHSSLSSSTFLGPGLGGKSGERGAYASFGRDAGVGGLTQAGFLSGELALNSPGPLSPSGMKGTSQYYPSYSGSSRRRAADGSLDTQPKKVRKVPPGLPSSVYPPSSGEDYGRDATAYPSAKTPSSTYPAPFYVADGSLHPSAELWSPPGQAGFGPMLGGGSSPLPLPPGSGPVGSSGSSSTFGGLHQHERMGYQLHGAEVNGGLPSASSFSSAPGATYGGVSSHTPPVSGADSLLGSRGTTAGSSGDALGKALASIYSPDHSSNNFSSSPSTPVGSPQGLAGTSQWPRAGAPGALSPSYDGGLHGLQSKIEDHLDEAIHVLRSHAVGTAGDMHTLLPGHGALASGFTGPMSLGGRHAGLVGGSHPEDGLAGSTSLMHNHAALPSQPGTLPDLSRPPDSYSGLGRAGATAAASEIKREEKEDEENTSAADHSEEEKKELKAPRARTSPDEDEDDLLPPEQKAEREKERRVANNARERLRVRDINEAFKELGRMCQLHLNSEKPQTKLLILHQAVSVILNLEQQVRERNLNPKAACLKRREEEKVSGVVGDPQMVLSAPHPGLSEAHNPAGHM DIP protein P15923 original sequence version: 171 DIP protein P15923 original sequence version: 132 DIP protein P15923 original sequence version: 126 52F5E3DE1890AE13 taf4_human Transcription initiation factor TFIID subunit 4 TAF4 TAF2C TAF2C1 TAF4A TAFII130 TAFII135 TBP-associated factor 4 Transcription initiation factor TFIID 135 kDa subunit Transcription initiation factor TFIID 130 kDa subunit RNA polymerase II TBP-associated factor subunit C protein protein human Homo sapiens Human MAAGSDLLDEVFFNSEVDEKVVSDLVGSLESQLAASAAHHHHLAPRTPEVRAAAAGALGNHVVSGSPAGAAGAGPAAPAEGAPGAAPEPPPAGRARPGGGGPQRPGPPSPRRPLVPAGPAPPAAKLRPPPEGSAGSCAPVPAAAAVAAGPEPAPAGPAKPAGPAALAARAGPGPGPGPGPGPGPGPGKPAGPGAAQTLNGSAALLNSHHAAAPAVSLVNNGPAALLPLPKPAAPGTVIQTPPFVGAAAPPAPAAPSPPAAPAPAAPAAAPPPPPPAPATLARPPGHPAGPPTAAPAVPPPAAAQNGGSAGAAPAPAPAAGGPAGVSGQPGPGAAAAAPAPGVKAESPKRVVQAAPPAAQTLAASGPASTAASMVIGPTMQGALPSPAAVPPPAPGTPTGLPKGAAGAVTQSLSRTPTATTSGIRATLTPTVLAPRLPQPPQNPTNIQNFQLPPGMVLVRSENGQLLMIPQQALAQMQAQAHAQPQTTMAPRPATPTSAPPVQISTVQAPGTPIIARQVTPTTIIKQVSQAQTTVQPSATLQRSPGVQPQLVLGGAAQTASLGTATAVQTGTPQRTVPGATTTSSAATETMENVKKCKNFLSTLIKLASSGKQSTETAANVKELVQNLLDGKIEAEDFTSRLYRELNSSPQPYLVPFLKRSLPALRQLTPDSAAFIQQSQQQPPPPTSQATTALTAVVLSSSVQRTAGKTAATVTSALQPPVLSLTQPTQVGVGKQGQPTPLVIQQPPKPGALIRPPQVTLTQTPMVALRQPHNRIMLTTPQQIQLNPLQPVPVVKPAVLPGTKALSAVSAQAAAAQKNKLKEPGGGSFRDDDDINDVASMAGVNLSEESARILATNSELVGTLTRSCKDETFLLQAPLQRRILEIGKKHGITELHPDVVSYVSHATQQRLQNLVEKISETAQQKNFSYKDDDRYEQASDVRAQLKFFEQLDQIEKQRKDEQEREILMRAAKSRSRQEDPEQLRLKQKAKEMQQQELAQMRQRDANLTALAAIGPRKKRKVDCPGPGSGAEGSGPGSVVPGSSGVGTPRQFTRQRITRVNLRDLIFCLENERETSHSLLLYKAFLK DIP protein O00268 original sequence version: 153 DIP protein O00268 original sequence version: 139 BC2F5B5F143DB145 taf4-crebzf-1 4 6 unspecified role unspecified role prey prey Region 71-90 Region 71-90 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 9 unspecified role unspecified role bait bait Region 575-688 Region 575-688 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction taf4-tcf3-1 2 8 unspecified role unspecified role unspecified role unspecified role Region 7-27 Region 7-27 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role Region 575-688 Region 575-688 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction crebzf-taf4-1 1 6 unspecified role unspecified role unspecified role unspecified role Region 71-90 Region 71-90 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role Region 575-688 Region 575-688 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction taf4-creb3-1 5 7 unspecified role unspecified role prey prey Region 46-63 Region 46-63 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 9 unspecified role unspecified role bait bait Region 575-688 Region 575-688 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction creb3-taf4-1 3 7 unspecified role unspecified role unspecified role unspecified role Region 46-63 Region 46-63 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role Region 575-688 Region 575-688 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction