DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. DIP original experiment: DIP-261424X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. DIP original experiment: DIP-261431X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. DIP original experiment: DIP-261427X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. DIP original experiment: DIP-261436X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. DIP original experiment: DIP-261433X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. DIP original experiment: DIP-261435X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. DIP original experiment: DIP-261426X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. DIP original experiment: DIP-261434X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. DIP original experiment: DIP-261428X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. DIP original experiment: DIP-261439X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. DIP original experiment: DIP-261430X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. DIP original experiment: DIP-261432X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. DIP original experiment: DIP-261429X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. Only protein-protein interactions emend Emericella nidulans Aspergillus nidulans tap tandem affinity purification TAP TAP tap ms participant Identification by mass spectrometry ms participant Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. DIP original experiment: DIP-261423X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. DIP original experiment: DIP-261438X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. DIP original experiment: DIP-261437X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. DIP original experiment: DIP-261440X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Busch S., Schwier EU., Nahlik K., Bayram O., Helmstaedt K., Draht OW., Krappmann S., Valerius O., Lipscomb WN., Braus GH. DIP original experiment: DIP-261425X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx An eight-subunit COP9 signalosome with an intact JAMM motif is required for fungal fruit body formation. csn3_emeni COP9 signalosome complex subunit 3 csnC csn3 AN5798 protein protein emeni Emericella nidulans Aspergillus nidulans MSDFLAYLTSAPSRPHGSANITDKCYDHQLRDLIAYLKQPGVAPSTADINGYLEAISPAVHSLSYLYLLRIRIQQLQEKTAVGVPNDLQPGGTLWNQTVKFLRSFDPIQIRYVGHEWRELVDSVANAALSVSKPILAVKMIRDALERLNTAGVFTSLHLMLVKLALLSSSYTYVLPVLDKLLCHFPSDTQNAHAGILLCSEHEPSTVFFTDSSGFSANLTYRDHLQFYMYSGMVYMALKKWDQASHCLGIVISAPTANSVSKIMVEAYKKWVLANLLGHGKLFSVPNLVAPHVTRVYQSLSKPYISLAEAFEKRDFQRLRTEISLGQTIWRADKNSGLVYQVFEAYDKFLIIKLGKTFSALTMPDVLQRASSCSKGSRDIEEFVVSLVMTKELRAKLSHSPGNETTTMLRFPLSSQSHALREEHIRFRLIQKEAALNTISRAITQTKITLETSHENLQVIAKNQKLAGSSERSGVVGSTEADGGGDLDEDLMGDGR DIP protein Q5B0Y2 original sequence version: 44 csn2_emeni COP9 signalosome complex subunit 2 csnB csn2 AN4783 protein protein emeni Emericella nidulans Aspergillus nidulans MSDDDDFMHDSADEEYDFEYEDADDDETGDIGIENKYYNAKQIKVDNPEEAIDEFLGVPALEQDKGDWGFKGLKQAIKLEFKLGRYSDAVEHYRELLTYVKSAVTRNYSEKSINNMLDYIEKGSDDEKAYQCMEEFYSLTLNSFQNTNNERLWLKTNIKLARLWLERREYGQLSKKVRELHRACQREDGSDDPSKGTYLLELYALEIQMYAETKNNKRLKALYQRALRVRSAVPHPKIMGIIRECGGKMHMSEENWEEAQSDFFESFRNYDEAGSMQRIQVLKYLVLTTMLMKSDINPFHSQETKPYKTDPRISAMTDLVDAFQRDDIHAYEEVLSKNPDVLADPFIAENIDEVSRNMRTKAILKLIAPYTRFTLSFISKHIKISVTEAQDILSFLILDKKLNAKIDQESGTVVVESASDVERLRSVEEWNESLRTLWQVTLKDGDGFKNDDVSQPTGIGMRGPLLYQSGLDDDTAGLLRSSGHRFRRGGKGSKAGGGLGMKTGLF DIP protein Q5B3U7 original sequence version: 51 csn6_emeni COP9 signalosome complex subunit 6 csnF csn6 AN2233 protein protein emeni Emericella nidulans Aspergillus nidulans MPDEAISILSQKSSDSGLHIQLHPLALLTISDHITRHAARSQQGPIVGGLLGQHNGREITVEHGFECVVEIGPNGEAQLPNEWFVDRVKQFKDVHKVPALDLIGWWSTAPPSGPTTAHLPIHRQILQNHNESAVFLTFHPSQVQGASQSQGKLPLTIYESVYEGESVTENGKAMQVDGEEQLLNIRFRELPYTIETGEAEMIGIDTVARTARNAAATETSTVAAPSSQIDSDKQEQQPANTDLLSPEEEELIASLNTRLNAIRTLESRISLIKSYLSSISPSSEEGQKDSATKPDHTILRDINSLLSNLSLLTPHEQSAFSAETLAQNNDVSLVALLGQLSQSVNGMREVGKRTAIVNSVRRNRKQLGAQSRYEDDILGRDGVALG DIP protein Q5BB47 original sequence version: 48 csn8_emeni COP9 signalosome complex subunit 8 csnH csn8 AN10208 protein protein emeni Emericella nidulans Aspergillus nidulans MDLPPLSLDQLSAVITAGPTPTDLYTSLSAYEEQACLLSATDPSEKDLLLEFYTAFFFSHLLTDQICEARALTRRIPREISRLDAMQTCSLLLRAVWQSKHTEIYKILRELPWPGRSQPLVQRYESYFQEKTLVEMSNSYETIRIAAAATYLGLDPAAVEGDIIEKFTACGWKWDSEKQLLHPKPVVTAPPKDDSLQNELSRVMALISNQGS DIP protein P0C624 original sequence version: 28 csn5_emeni COP9 signalosome complex subunit 5 rri1 csn5 csnE AN2129 protein protein emeni Emericella nidulans Aspergillus nidulans MQAAQLSWELENAVTLIDPQRDSLYRYDEETHKYLSDTRPWTKDPHYFKSVRISAVALLKMVMHARSGGSLEVMGLMQGYILPNTFVVTDAFRLPVEGTETRVNAQDEANEYMVSYLQSCREAGRMENAVGWYHSHPGYGCWLSGIDVSTQDMQQMSGPFVAVVIDPERTISAGKVDIGAFRTFPKDYTPPKEEQEEDEYQTVPLNKAEDFGAHASHYYSLEVSLFKSALDTEILSLLWNKYWVATLSQSPLFTTRDYGSKQMLDLSQKTRRVARGIESNPPRGGAPTQVRDQQLERVVKDGQRIVSEEVKGLLAAEVKMQLFQGIGGKQTVEST DIP protein Q5BBF1 original sequence version: 60 csn4_emeni COP9 signalosome complex subunit 4 csnD csn4 AN1539 protein protein emeni Emericella nidulans Aspergillus nidulans MPSQKIISALAEIESSASPQNKLQLYNDLLSETVSASPEPQLADDLIYYLDSVLSEDLSIVAARPILDSFIYTLRKLSSETQIKVAQHAVNLLQSRSASVEEQDAQIREILADAYEAEEEYIAAARALQGIHIDSSQRLVSDSAKVKLWIRIVRLYLEEDDTTSAEAFLNRIKNLPSKIEDHELKLHFRLSQARIQDARRRFLDASQEYFAVSLAAGVDESDRLQALAAAIRCAVLAPAGPQRSRTLATLYKDDRATSVEEFGILEKMFLDRLLTPEEVSAFAQRLAPHQLAQTADGTTVLDKAVVEHNLVAASKLYENIKTDALGAILGLQASGDLTAGEKAEAYAARMVEQGRLSGSIDQIDGIIYFESNTTATGRHIRQWDAGVQGLSEGVERVATNIAEGHLVR DIP protein Q9C467 original sequence version: 62 csn7_emeni COP9 signalosome complex subunit 7 csnG acoB csn7 AN3623 protein protein emeni Emericella nidulans Aspergillus nidulans MDQVHHRALDALQSFIALTDSSSATSPRYIASIITNATSSPHTYVFAELLERPAVQALRSPDTPAEFQSYLTLLEIFAWGTWQDYQQTPNLPPLSEEQARKLRLLTLLSLASTIKPLTYEALMTSLSLSAPSELESLVTTAIYSSLITGRLSPATNPPTVNVTSVAPLRDVKPSSLPTMISTLTAWEARCGSVISDIETEIAKIRADSAQRRQKEHARAVAIEKTLEKWNAEGGEQLQGGNPGQGQGQGQGGLGKNAGWKPRDLSTAMFERGFFGGGSNKREFDDDGYFDGGSSDFDQHGSGMDIDEGAGARASGARHSKRFLGKKS DIP protein Q00648 original sequence version: 60 csn1_emeni COP9 signalosome complex subunit 1 csnA csn1 AN1491 protein protein emeni Emericella nidulans Aspergillus nidulans MEPMLPEAGEAALLSSYAPQASGSMGVDPDPITGLVSTSAAPLVRVEEAPKFELESYIANYTGRTRFNRLYLIGTCSSYLAVDALKAAIAEAKSGKDVARYLRAVQALADVAPNEPEATIDSDWVERSQKVVKAETDRLEHELRGYKNNLIKESIRMGNEELGQHYHRIGDLTSAFKAYSRMRDFCTTPSHIASMLFKIINVAIERGDWLNVQSNVHRLRSQGGKPEEQAKHQPKISAAMGLSQLHSGSYLEAANSFIATDPSLGDTFNEVLTSNDVAVYGGLCALASMDRNELQRRVLDNSSFRNFLELEPHIRRAISFFCNSKFRPCLEILEAYRADYLLDIHLQRHVQVLYNRIRTKSIQQYLIPFNRVSLESMAKIFVLGNPTSQSSQSDSKSAFVQELISLIQDGTLDARIDLEKHVLVSTQGDKRIEVQEAVLDSLDNYVREAHLRLLRSNIIRAGLEVRPLGEDRRTKLEERGKKGHSAIGNLLRATGMKQ DIP protein Q5BD89 original sequence version: 49 csnb-csng-1 12 25 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 20 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association rri1-csna-1 14 22 unspecified role unspecified role prey prey emend Emericella nidulans Aspergillus nidulans 25 unspecified role unspecified role prey prey emend Emericella nidulans Aspergillus nidulans 21 unspecified role unspecified role prey prey emend Emericella nidulans Aspergillus nidulans 23 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range emend Emericella nidulans Aspergillus nidulans 24 unspecified role unspecified role prey prey emend Emericella nidulans Aspergillus nidulans 19 unspecified role unspecified role prey prey emend Emericella nidulans Aspergillus nidulans 20 unspecified role unspecified role prey prey emend Emericella nidulans Aspergillus nidulans 26 unspecified role unspecified role prey prey emend Emericella nidulans Aspergillus nidulans association association csnb-csna-1 7 20 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 26 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association csnf-csng-1 16 21 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 25 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association csna-csnd-1 3 24 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 26 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association rri1-csnf-1 10 23 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 21 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association csnf-rri1-1 15 23 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 21 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association csnd-csnd-1 5 24 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 24 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association csnd-csna-1 9 24 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 26 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association csnb-csnb-1 13 20 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 20 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association csnf-csnf-1 17 21 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 21 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association csng-csnd-1 6 25 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 24 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association csna-csna-1 1 26 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 26 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association csnd-csng-1 8 25 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 24 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association csng-csnf-1 4 21 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 25 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association csna-csnb-1 18 20 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 26 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association csnb-csnd-1 11 24 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 20 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association csnd-csnb-1 2 24 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 20 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association