DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu BetaKlotho is required for metabolic activity of fibroblast growth factor 21. BetaKlotho is required for metabolic activity of fibroblast growth factor 21. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Ogawa Y., Kurosu H., Yamamoto M., Nandi A., Rosenblatt KP., Goetz R., Eliseenkova AV., Mohammadi M., Kuro-o M. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Ogawa Y., Kurosu H., Yamamoto M., Nandi A., Rosenblatt KP., Goetz R., Eliseenkova AV., Mohammadi M., Kuro-o M. DIP original experiment: DIP-261380X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx BetaKlotho is required for metabolic activity of fibroblast growth factor 21. BetaKlotho is required for metabolic activity of fibroblast growth factor 21. BetaKlotho is required for metabolic activity of fibroblast growth factor 21. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Ogawa Y., Kurosu H., Yamamoto M., Nandi A., Rosenblatt KP., Goetz R., Eliseenkova AV., Mohammadi M., Kuro-o M. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Ogawa Y., Kurosu H., Yamamoto M., Nandi A., Rosenblatt KP., Goetz R., Eliseenkova AV., Mohammadi M., Kuro-o M. DIP original experiment: DIP-261381X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx BetaKlotho is required for metabolic activity of fibroblast growth factor 21. BetaKlotho is required for metabolic activity of fibroblast growth factor 21. BetaKlotho is required for metabolic activity of fibroblast growth factor 21. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Ogawa Y., Kurosu H., Yamamoto M., Nandi A., Rosenblatt KP., Goetz R., Eliseenkova AV., Mohammadi M., Kuro-o M. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ogawa Y., Kurosu H., Yamamoto M., Nandi A., Rosenblatt KP., Goetz R., Eliseenkova AV., Mohammadi M., Kuro-o M. DIP original experiment: DIP-261384X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx BetaKlotho is required for metabolic activity of fibroblast growth factor 21. BetaKlotho is required for metabolic activity of fibroblast growth factor 21. BetaKlotho is required for metabolic activity of fibroblast growth factor 21. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Ogawa Y., Kurosu H., Yamamoto M., Nandi A., Rosenblatt KP., Goetz R., Eliseenkova AV., Mohammadi M., Kuro-o M. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Ogawa Y., Kurosu H., Yamamoto M., Nandi A., Rosenblatt KP., Goetz R., Eliseenkova AV., Mohammadi M., Kuro-o M. DIP original experiment: DIP-261383X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx BetaKlotho is required for metabolic activity of fibroblast growth factor 21. BetaKlotho is required for metabolic activity of fibroblast growth factor 21. BetaKlotho is required for metabolic activity of fibroblast growth factor 21. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Ogawa Y., Kurosu H., Yamamoto M., Nandi A., Rosenblatt KP., Goetz R., Eliseenkova AV., Mohammadi M., Kuro-o M. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Ogawa Y., Kurosu H., Yamamoto M., Nandi A., Rosenblatt KP., Goetz R., Eliseenkova AV., Mohammadi M., Kuro-o M. DIP original experiment: DIP-261382X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx BetaKlotho is required for metabolic activity of fibroblast growth factor 21. fgfr4_mouse Fibroblast growth factor receptor 4 Fgfr4 Fgfr-4 Mpk-11 Protein-tyrosine kinase receptor MPK-11 protein protein mouse Mus musculus Mouse MWLLLALLSIFQGTPALSLEASEEMEQEPCLAPILEQQEQVLTVALGQPVRLCCGRTERGRHWYKEGSRLASAGRVRGWRGRLEIASFLPEDAGRYLCLARGSMTVVHNLTLLMDDSLTSISNDEDPKTLSSSSSGHVYPQQAPYWTHPQRMEKKLHAVPAGNTVKFRCPAAGNPMPTIHWLKDGQAFHGENRIGGIRLRHQHWSLVMESVVPSDRGTYTCLVENSLGSIRYSYLLDVLERSPHRPILQAGLPANTTAVVGSDVELLCKVYSDAQPHIQWLKHVVINGSSFGADGFPYVQVLKTTDINSSEVEVLYLRNVSAEDAGEYTCLAGNSIGLSYQSAWLTVLPEEDLTWTTATPEARYTDIILYVSGSLVLLVLLLLAGVYHRQVIRGHYSRQPVTIQKLSRFPLARQFSLESRSSGKSSLSLVRGVRLSSSGPPLLTGLVNLDLPLDPLWEFPRDRLVLGKPLGEGCFGQVVRAEAFGMDPSRPDQTSTVAVKMLKDNASDKDLADLVSEMEVMKLIGRHKNIINLLGVCTQEGPLYVIVECAAKGNLREFLRARRPPGPDLSPDGPRSSEGPLSFPALVSCAYQVARGMQYLESRKCIHRDLAARNVLVTEDDVMKIADFGLARGVHHIDYYKKTSNGRLPVKWMAPEALFDRVYTHQSDVWSFEILLWEIFTLGGSPYPGIPVEELFSLLREGHRMERPPNCPSELYGLMRECWHAAPSQRPTFKQLVEALDKVLLAVSEEYLDLRLTFGPFSPSNGDASSTCSSSDSVFSHDPLPLEPSPFPFSDSQTT DIP protein Q03142 original sequence version: 145 DIP protein Q03142 original sequence version: 109 klotb_mouse Beta-klotho Klb Betakl Klotho beta-like protein protein protein mouse Mus musculus Mouse MKTGCAAGSPGNEWIFFSSDERNTRSRKTMSNRALQRSAVLSAFVLLRAVTGFSGDGKAIWDKKQYVSPVNPSQLFLYDTFPKNFSWGVGTGAFQVEGSWKTDGRGPSIWDRYVYSHLRGVNGTDRSTDSYIFLEKDLLALDFLGVSFYQFSISWPRLFPNGTVAAVNAQGLRYYRALLDSLVLRNIEPIVTLYHWDLPLTLQEEYGGWKNATMIDLFNDYATYCFQTFGDRVKYWITIHNPYLVAWHGFGTGMHAPGEKGNLTAVYTVGHNLIKAHSKVWHNYDKNFRPHQKGWLSITLGSHWIEPNRTDNMEDVINCQHSMSSVLGWFANPIHGDGDYPEFMKTGAMIPEFSEAEKEEVRGTADFFAFSFGPNNFRPSNTVVKMGQNVSLNLRQVLNWIKLEYDDPQILISENGWFTDSYIKTEDTTAIYMMKNFLNQVLQAIKFDEIRVFGYTAWTLLDGFEWQDAYTTRRGLFYVDFNSEQKERKPKSSAHYYKQIIQDNGFPLKESTPDMKGRFPCDFSWGVTESVLKPEFTVSSPQFTDPHLYVWNVTGNRLLYRVEGVRLKTRPSQCTDYVSIKKRVEMLAKMKVTHYQFALDWTSILPTGNLSKVNRQVLRYYRCVVSEGLKLGVFPMVTLYHPTHSHLGLPLPLLSSGGWLNMNTAKAFQDYAELCFRELGDLVKLWITINEPNRLSDMYNRTSNDTYRAAHNLMIAHAQVWHLYDRQYRPVQHGAVSLSLHCDWAEPANPFVDSHWKAAERFLQFEIAWFADPLFKTGDYPSVMKEYIASKNQRGLSSSVLPRFTAKESRLVKGTVDFYALNHFTTRFVIHKQLNTNRSVADRDVQFLQDITRLSSPSRLAVTPWGVRKLLAWIRRNYRDRDIYITANGIDDLALEDDQIRKYYLEKYVQEALKAYLIDKVKIKGYYAFKLTEEKSKPRFGFFTSDFRAKSSVQFYSKLISSSGLPAENRSPACGQPAEDTDCTICSFLVEKKPLIFFGCCFISTLAVLLSITVFHHQKRRKFQKARNLQNIPLKKGHSRVFS DIP protein Q99N32 original sequence version: 97 fgfr1_mouse Fibroblast growth factor receptor 1 Fgfr1 Flg Basic fibroblast growth factor receptor 1 MFR Proto-oncogene c-Fgr protein protein mouse Mus musculus Mouse MWGWKCLLFWAVLVTATLCTARPAPTLPEQAQPWGVPVEVESLLVHPGDLLQLRCRLRDDVQSINWLRDGVQLVESNRTRITGEEVEVRDSIPADSGLYACVTSSPSGSDTTYFSVNVSDALPSSEDDDDDDDSSSEEKETDNTKPNRRPVAPYWTSPEKMEKKLHAVPAAKTVKFKCPSSGTPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENEYGSINHTYQLDVVERSPHRPILQAGLPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKIGPDNLPYVQILKTAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLEALEERPAVMTSPLYLEIIIYCTGAFLISCMLGSVIIYKMKSGTKKSDFHSQMAVHKLAKSIPLRRQVTVSADSSASMNSGVLLVRPSRLSSSGTPMLAGVSEYELPEDPRWELPRDRLVLGKPLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDATEKDLSDLISEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLQARRPPGLEYCYNPSHNPEEQLSSKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMDKPSNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIVALTSNQEYLDLSIPLDQYSPSFPDTRSSTCSSGEDSVFSHEPLPEEPCLPRHPTQLANSGLKRR DIP protein P16092 original sequence version: 162 DIP protein P16092 original sequence version: 124 mint Receptor for basic fibroblast growth factor. A shorter form of the receptor could be a receptor for FGF1 (aFGF) homomint D5A4695FA680926B fgf21_mouse Fibroblast growth factor 21 Fgf21 protein protein mouse Mus musculus Mouse MEWMRSRVGTLGLWVRLLLAVFLLGVYQAYPIPDSSPLLQFGGQVRQRYLYTDDDQDTEAHLEIREDGTVVGAAHRSPESLLELKALKPGVIQILGVKASRFLCQQPDGALYGSPHFDPEACSFRELLLEDGYNVYQSEAHGLPLRLPQKDSPNQDATSWGPVRFLPMPGLLHEPQDQAGFLPPEPPDVGSSDPLSMVEPLQGRSPSYAS DIP protein Q9JJN1 original sequence version: 97 fgfr1-klb-1 1 8 unspecified role unspecified role bait bait V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 7 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association fgfr1-klb-2 3 8 unspecified role unspecified role bait bait mouse Mus musculus Mouse 7 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association fgfr4-klb-1 2 6 unspecified role unspecified role bait bait V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 7 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association fgfr4-fgf21-1 4 6 unspecified role unspecified role bait bait V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 9 unspecified role unspecified role prey prey human Homo sapiens Human 7 unspecified role unspecified role prey prey human Homo sapiens Human association association fgfr1-fgf21-1 5 8 unspecified role unspecified role bait bait V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 9 unspecified role unspecified role prey prey human Homo sapiens Human 7 unspecified role unspecified role prey prey human Homo sapiens Human association association