DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Sterol-regulated transport of SREBPs from endoplasmic reticulum to Golgi: oxysterols block transport by binding to Insig. Sterol-regulated transport of SREBPs from endoplasmic reticulum to Golgi: oxysterols block transport by binding to Insig. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Radhakrishnan A., Ikeda Y., Kwon HJ., Brown MS., Goldstein JL. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Radhakrishnan A., Ikeda Y., Kwon HJ., Brown MS., Goldstein JL. DIP original experiment: DIP-261365X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Sterol-regulated transport of SREBPs from endoplasmic reticulum to Golgi: oxysterols block transport by binding to Insig. Sterol-regulated transport of SREBPs from endoplasmic reticulum to Golgi: oxysterols block transport by binding to Insig. Sterol-regulated transport of SREBPs from endoplasmic reticulum to Golgi: oxysterols block transport by binding to Insig. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Radhakrishnan A., Ikeda Y., Kwon HJ., Brown MS., Goldstein JL. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Radhakrishnan A., Ikeda Y., Kwon HJ., Brown MS., Goldstein JL. DIP original experiment: DIP-261364X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Sterol-regulated transport of SREBPs from endoplasmic reticulum to Golgi: oxysterols block transport by binding to Insig. insi2_human Insulin-induced gene 2 protein INSIG2 protein protein human Homo sapiens Human MAEGETESPGPKKCGPYISSVTSQSVNLMIRGVVLFFIGVFLALVLNLLQIQRNVTLFPPDVIASIFSSAWWVPPCCGTASAVIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINHASAKVDFDNNIQLSLTLAALSIGLWWTFDRSRSGFGLGVGIAFLATVVTQLLVYNGVYQYTSPDFLYVRSWLPCIFFAGGITMGNIGRQLAMYECKVIAEKSHQE DIP protein Q9Y5U4 original sequence version: 77 DIP protein Q9Y5U4 original sequence version: 90 mint homomint 13E0392F1B30F08C scap_crigr Sterol regulatory element-binding protein cleavage-activating protein SCAP protein protein crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster MTLTERLREKISQAFYNHGLLCASYPIPIILFTGLCILACCYPLLKLPLPGTGPVEFSTPVKDYSPPPVDSDHKQGEPSEQPEWYVGAPVAYIQQIFVKSSVSPWHKNLLAVDVFRLPLSRAFQLVEEIRNHVLRDSSGTKSLEEVCLQVTDLLPGLRKLRNLLPEHGCLLLSPGNFWQNDWERFHADPDIIGTIHQHEPKTLQTSATLKDLLFGVPGKYSGVSLYTRKRTVSYTITLVFQRYHAKFLSSLRARLMLLHPSPNCSLRAENLVHVHFKEEIGIAELIPLVTTYIILFAYIYFSTRKIDMVKSKWGLALAAVVTVLSSLLMSVGLCTLFGLTPTLNGGEIFPYLVVVIGLENVLVLTKSVVSTPVDLEVKLRIAQGLSSESWSIMKNVATELGIILIGYFTLVPAIQEFCLFAVVGLVSDFFLQMFFFTTVLSIDIRRMELADLNKRLPPESCLPSAKPVGRPARYERQLAVRPAMPHTITLQPSSFRNLRLPKRLRVIYFLARTRLAQRLIMAGTVVWIGILVYTDPAGLRTYLAAQVTEQSPLGEGSLGPMPVPSGVLPASRPDPAFSIFPPDAPKLPENQTVPGELPEHAAPAEGVHDSRAPEVTWGPEDEELWRRLSFRHWPTLFNYYNITLAKRYISLLPVIPVTLRLNPQEALEGRQPQDGRSAWAPPESLPAGLWEAGPKGPGGTQAHGDITLYKVAALGLAAGIVLVLLLLCLYRVLCPRNYGQPGGGAGRRRRGELPCDDYGYAPPETEIVPLVLRGHLMDIECLASDGMLLVSCCLAGQVCVWDAQTGDCLTRIPRPGSRRDSCGGGAFETQENWERLSDGGKTSPEEPGESPPLRHRPRGPPQPALFGDQPDLTCLIDTNFSVQLPPEPTQPEPRHRAGCGRARDSGYDFSRLVQRVYQEEGLAAVRMPALRPPSPGSPLPQASQEDGAAPEKGSPPLAWAPSTAGSIWSLELQGNLIVVGRSSGRLEVWDAIEGVLCCSNDEVSSGITALVFLDRRIVAARLNGSLDFFSLETHTSLSPLQFRGTPGRGSSPSSSVYSSSNTVACHLTHTVPCAHQKPITALRAAAGRLVTGSQDHTLRVFRLEDSCCLFTLQGHSGAITTVYIDQTMVLASGGQDGAICLWDVLTGSRVSHTFAHRGDVTSLTCTTSCVISSGLDDLINIWDRSTGIKLYSIQQDLGCGASLGVISDNLLVTGGQGCVSFWDLNYGDLLQTVYLGKNSEAQPARQILVLDNAAIVCNFGSELSLVYVPSVLEKLD DIP protein P97260 original sequence version: 107 DIP protein P97260 original sequence version: 103 A8693F7157FF5FFC insig2-scap-1 2 3 unspecified role unspecified role bait bait Q9Y5U4:p.Phe115Ala F115A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F115A'. Wed May 02 18:39:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe115ala' Tue Jun 30 17:15:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe115Ala' Q9Y5U4:p.Thr136Ala T136A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain T A This feature has been corrected as a result of our quality control procedures. The original label was 'T136A'. Wed May 02 17:30:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr136ala' Tue Jun 30 18:01:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr136Ala' Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 4 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association insig2-1 1 3 unspecified role unspecified role unspecified role unspecified role Region 32-207 Region 32-207 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction