DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural insights into the degradation of Mcl-1 induced by BH3 domains. Structural insights into the degradation of Mcl-1 induced by BH3 domains. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Czabotar PE., Lee EF., van Delft MF., Day CL., Smith BJ., Huang DC., Fairlie WD., Hinds MG., Colman PM. Only protein-protein interactions in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Czabotar PE., Lee EF., van Delft MF., Day CL., Smith BJ., Huang DC., Fairlie WD., Hinds MG., Colman PM. DIP original experiment: DIP-261293X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structural insights into the degradation of Mcl-1 induced by BH3 domains. Structural insights into the degradation of Mcl-1 induced by BH3 domains. Structural insights into the degradation of Mcl-1 induced by BH3 domains. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Czabotar PE., Lee EF., van Delft MF., Day CL., Smith BJ., Huang DC., Fairlie WD., Hinds MG., Colman PM. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Czabotar PE., Lee EF., van Delft MF., Day CL., Smith BJ., Huang DC., Fairlie WD., Hinds MG., Colman PM. DIP original experiment: DIP-261292X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structural insights into the degradation of Mcl-1 induced by BH3 domains. mcl1_mouse Induced myeloid leukemia cell differentiation protein Mcl-1 homolog Bcl-2-related protein EAT/mcl1 Mcl1 protein protein mouse Mus musculus Mouse MFGLRRNAVIGLNLYCGGASLGAGGGSPAGARLVAEEAKARREGGGEAALLPGARVVARPPPVGAEDPDVTASAERRLHKSPGLLAVPPEEMAASAAAAIVSPEEELDGCEPEAIGKRPAVLPLLERVSEAAKSSGADGSLPSTPPPPEEEEDDLYRQSLEIISRYLREQATGSKDSKPLGEAGAAGRRALETLRRVGDGVQRNHETAFQGMLRKLDIKNEGDVKSFSRVMVHVFKDGVTNWGRIVTLISFGAFVAKHLKSVNQESFIEPLAETITDVLVRTKRDWLVKQRGWDGFVEFFHVQDLEGGIRNVLLAFAGVAGVGAGLAYLIR DIP protein P97287 original sequence version: 123 E4FD369DB0EC6723 apr_mouse Phorbol-12-myristate-13-acetate-induced protein 1 Pmaip1 Noxa Protein Noxa protein protein mouse Mus musculus Mouse MPGRKARRNAPVNPTRAELPPEFAAQLRKIGDKVYCTWSAPDITVVLAQMPGKSQKSRMRSPSPTRVPADLKDECAQLRRIGDKVNLRQKLLNLISKLFNLVT DIP protein Q9JM54 original sequence version: 102 DIP protein Q9JM54 original sequence version: 115 9B9A5B04D5535E30 mcl1-pmaip1-2 2 3 unspecified role unspecified role unspecified role unspecified role Region 152-308 Region 152-308 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 4 unspecified role unspecified role unspecified role unspecified role Region 68-93 Region 68-93 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction mcl1-pmaip1-3 1 4 unspecified role unspecified role unspecified role unspecified role Region 68-93 Region 68-93 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 3 unspecified role unspecified role unspecified role unspecified role Region 152-308 Region 152-308 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction