DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural basis for the selection of glycosylated substrates by SCF(Fbs1) ubiquitin ligase. Structural basis for the selection of glycosylated substrates by SCF(Fbs1) ubiquitin ligase. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Mizushima T., Yoshida Y., Kumanomidou T., Hasegawa Y., Suzuki A., Yamane T., Tanaka K. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Mizushima T., Yoshida Y., Kumanomidou T., Hasegawa Y., Suzuki A., Yamane T., Tanaka K. DIP original experiment: DIP-261284X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structural basis for the selection of glycosylated substrates by SCF(Fbs1) ubiquitin ligase. Structural basis for the selection of glycosylated substrates by SCF(Fbs1) ubiquitin ligase. Structural basis for the selection of glycosylated substrates by SCF(Fbs1) ubiquitin ligase. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Mizushima T., Yoshida Y., Kumanomidou T., Hasegawa Y., Suzuki A., Yamane T., Tanaka K. Only protein-protein interactions ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Mizushima T., Yoshida Y., Kumanomidou T., Hasegawa Y., Suzuki A., Yamane T., Tanaka K. DIP original experiment: DIP-261282X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structural basis for the selection of glycosylated substrates by SCF(Fbs1) ubiquitin ligase. Structural basis for the selection of glycosylated substrates by SCF(Fbs1) ubiquitin ligase. Structural basis for the selection of glycosylated substrates by SCF(Fbs1) ubiquitin ligase. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Mizushima T., Yoshida Y., Kumanomidou T., Hasegawa Y., Suzuki A., Yamane T., Tanaka K. Only protein-protein interactions ecolx Escherichia coli ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Mizushima T., Yoshida Y., Kumanomidou T., Hasegawa Y., Suzuki A., Yamane T., Tanaka K. DIP original experiment: DIP-261281X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structural basis for the selection of glycosylated substrates by SCF(Fbs1) ubiquitin ligase. Structural basis for the selection of glycosylated substrates by SCF(Fbs1) ubiquitin ligase. Structural basis for the selection of glycosylated substrates by SCF(Fbs1) ubiquitin ligase. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Mizushima T., Yoshida Y., Kumanomidou T., Hasegawa Y., Suzuki A., Yamane T., Tanaka K. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Mizushima T., Yoshida Y., Kumanomidou T., Hasegawa Y., Suzuki A., Yamane T., Tanaka K. DIP original experiment: DIP-261279X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structural basis for the selection of glycosylated substrates by SCF(Fbs1) ubiquitin ligase. Structural basis for the selection of glycosylated substrates by SCF(Fbs1) ubiquitin ligase. Structural basis for the selection of glycosylated substrates by SCF(Fbs1) ubiquitin ligase. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Mizushima T., Yoshida Y., Kumanomidou T., Hasegawa Y., Suzuki A., Yamane T., Tanaka K. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Mizushima T., Yoshida Y., Kumanomidou T., Hasegawa Y., Suzuki A., Yamane T., Tanaka K. DIP original experiment: DIP-261283X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structural basis for the selection of glycosylated substrates by SCF(Fbs1) ubiquitin ligase. Structural basis for the selection of glycosylated substrates by SCF(Fbs1) ubiquitin ligase. Structural basis for the selection of glycosylated substrates by SCF(Fbs1) ubiquitin ligase. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Mizushima T., Yoshida Y., Kumanomidou T., Hasegawa Y., Suzuki A., Yamane T., Tanaka K. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Mizushima T., Yoshida Y., Kumanomidou T., Hasegawa Y., Suzuki A., Yamane T., Tanaka K. DIP original experiment: DIP-261280X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structural basis for the selection of glycosylated substrates by SCF(Fbs1) ubiquitin ligase. p63208-1 S-phase kinase-associated protein 1 SKP1 EMC19 OCP2 SKP1A TCEB1L Cyclin-A/CDK2-associated protein p19 Organ of Corti protein 2 Organ of Corti protein II RNA polymerase II elongation factor-like protein SIII p19skp1 Transcription elongation factor B polypeptide 1-like protein protein human Homo sapiens Human MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK DIP protein P63208-1 original sequence version: 128 DIP protein P63208-1 original sequence version: 116 DIP protein P63208 original sequence version: 76 DIP protein P63208-1 original sequence version: 76 DIP protein P63208 original sequence version: 104 DIP protein P63208 original sequence version: 127 DIP protein P63208 original sequence version: 123 DIP protein P63208 original sequence version: 61 DIP protein P63208 original sequence version: 91 DIP protein P63208 original sequence version: 115 DIP protein P63208 original sequence version: 94 DIP protein P63208 original sequence version: 75 DIP protein P63208 original sequence version: 85 C794D62AFB75528A rnas1_bovin Ribonuclease pancreatic RNASE1 RNS1 RNase 1 RNase A protein protein bovin Bos taurus (Bovine) Bovine MALKSLVLLSLLVLVLLLVRVQPSLGKETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV DIP protein P61823 original sequence version: 104 74E5DC61E679187D fbx2_mouse F-box only protein 2 Fbs1 Fbxo2 Fbx2 protein protein mouse Mus musculus Mouse MDGDGDPESVSHPEEASPEEQPEEAGAEASAEEEQLREAEEEEEAEAVEYLAELPEPLLLRVLAELPATELVQACRLVCLRWKELVDGAPLWLLKCQQEGLVPEGSADEERDHWQQFYFLSKRRRNLLRNPCGEEDLEGWSDVEHGGDGWRVEELPGDNGVEFTQDDSVKKYFASSFEWCRKAQVIDLQAEGYWEELLDTTQPAIVVKDWYSGRTDAGSLYELTVRLLSENEDVLAEFATGQVAVPEDGSWMEISHTFIDYGPGVRFVRFEHGGQDSVYWKGWFGARVTNSSVWVEP DIP protein Q80UW2 original sequence version: 90 E0F8A5601CE5930C fbxo2-rnase1-1 1 8 unspecified role unspecified role unspecified role unspecified role Region 27-150 Region 27-150 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain bovin Bos taurus (Bovine) Bovine 9 unspecified role unspecified role unspecified role unspecified role Region 105-297 Region 105-297 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction fbxo2-skp1-7 4 9 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction skp1-fbxo2-3 2 9 unspecified role unspecified role prey prey ecolx Escherichia coli 7 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association fbxo2-skp1-8 6 9 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction fbxo2-rnase1-2 5 8 unspecified role unspecified role unspecified role unspecified role Region 27-150 Region 27-150 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain bovin Bos taurus (Bovine) Bovine 9 unspecified role unspecified role unspecified role unspecified role Region 105-297 Region 105-297 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction fbxo2-skp1-9 3 9 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction