DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu NF-kappaB activation by the Toll-IL-1 receptor domain protein MyD88 adapter-like is regulated by caspase-1. NF-kappaB activation by the Toll-IL-1 receptor domain protein MyD88 adapter-like is regulated by caspase-1. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Miggin SM., Pålsson-McDermott E., Dunne A., Jefferies C., Pinteaux E., Banahan K., Murphy C., Moynagh P., Yamamoto M., Akira S., Rothwell N., Golenbock D., Fitzgerald KA., O'Neill LA. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Miggin SM., Pålsson-McDermott E., Dunne A., Jefferies C., Pinteaux E., Banahan K., Murphy C., Moynagh P., Yamamoto M., Akira S., Rothwell N., Golenbock D., Fitzgerald KA., O'Neill LA. DIP original experiment: DIP-261116X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx NF-kappaB activation by the Toll-IL-1 receptor domain protein MyD88 adapter-like is regulated by caspase-1. NF-kappaB activation by the Toll-IL-1 receptor domain protein MyD88 adapter-like is regulated by caspase-1. NF-kappaB activation by the Toll-IL-1 receptor domain protein MyD88 adapter-like is regulated by caspase-1. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Miggin SM., Pålsson-McDermott E., Dunne A., Jefferies C., Pinteaux E., Banahan K., Murphy C., Moynagh P., Yamamoto M., Akira S., Rothwell N., Golenbock D., Fitzgerald KA., O'Neill LA. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Miggin SM., Pålsson-McDermott E., Dunne A., Jefferies C., Pinteaux E., Banahan K., Murphy C., Moynagh P., Yamamoto M., Akira S., Rothwell N., Golenbock D., Fitzgerald KA., O'Neill LA. DIP original experiment: DIP-261119X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx NF-kappaB activation by the Toll-IL-1 receptor domain protein MyD88 adapter-like is regulated by caspase-1. NF-kappaB activation by the Toll-IL-1 receptor domain protein MyD88 adapter-like is regulated by caspase-1. NF-kappaB activation by the Toll-IL-1 receptor domain protein MyD88 adapter-like is regulated by caspase-1. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Miggin SM., Pålsson-McDermott E., Dunne A., Jefferies C., Pinteaux E., Banahan K., Murphy C., Moynagh P., Yamamoto M., Akira S., Rothwell N., Golenbock D., Fitzgerald KA., O'Neill LA. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Miggin SM., Pålsson-McDermott E., Dunne A., Jefferies C., Pinteaux E., Banahan K., Murphy C., Moynagh P., Yamamoto M., Akira S., Rothwell N., Golenbock D., Fitzgerald KA., O'Neill LA. DIP original experiment: DIP-261117X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx NF-kappaB activation by the Toll-IL-1 receptor domain protein MyD88 adapter-like is regulated by caspase-1. NF-kappaB activation by the Toll-IL-1 receptor domain protein MyD88 adapter-like is regulated by caspase-1. NF-kappaB activation by the Toll-IL-1 receptor domain protein MyD88 adapter-like is regulated by caspase-1. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Miggin SM., Pålsson-McDermott E., Dunne A., Jefferies C., Pinteaux E., Banahan K., Murphy C., Moynagh P., Yamamoto M., Akira S., Rothwell N., Golenbock D., Fitzgerald KA., O'Neill LA. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Miggin SM., Pålsson-McDermott E., Dunne A., Jefferies C., Pinteaux E., Banahan K., Murphy C., Moynagh P., Yamamoto M., Akira S., Rothwell N., Golenbock D., Fitzgerald KA., O'Neill LA. DIP original experiment: DIP-261118X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx NF-kappaB activation by the Toll-IL-1 receptor domain protein MyD88 adapter-like is regulated by caspase-1. NF-kappaB activation by the Toll-IL-1 receptor domain protein MyD88 adapter-like is regulated by caspase-1. NF-kappaB activation by the Toll-IL-1 receptor domain protein MyD88 adapter-like is regulated by caspase-1. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Miggin SM., Pålsson-McDermott E., Dunne A., Jefferies C., Pinteaux E., Banahan K., Murphy C., Moynagh P., Yamamoto M., Akira S., Rothwell N., Golenbock D., Fitzgerald KA., O'Neill LA. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Miggin SM., Pålsson-McDermott E., Dunne A., Jefferies C., Pinteaux E., Banahan K., Murphy C., Moynagh P., Yamamoto M., Akira S., Rothwell N., Golenbock D., Fitzgerald KA., O'Neill LA. DIP original experiment: DIP-261121X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx NF-kappaB activation by the Toll-IL-1 receptor domain protein MyD88 adapter-like is regulated by caspase-1. NF-kappaB activation by the Toll-IL-1 receptor domain protein MyD88 adapter-like is regulated by caspase-1. NF-kappaB activation by the Toll-IL-1 receptor domain protein MyD88 adapter-like is regulated by caspase-1. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Miggin SM., Pålsson-McDermott E., Dunne A., Jefferies C., Pinteaux E., Banahan K., Murphy C., Moynagh P., Yamamoto M., Akira S., Rothwell N., Golenbock D., Fitzgerald KA., O'Neill LA. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Miggin SM., Pålsson-McDermott E., Dunne A., Jefferies C., Pinteaux E., Banahan K., Murphy C., Moynagh P., Yamamoto M., Akira S., Rothwell N., Golenbock D., Fitzgerald KA., O'Neill LA. DIP original experiment: DIP-261120X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx NF-kappaB activation by the Toll-IL-1 receptor domain protein MyD88 adapter-like is regulated by caspase-1. casp1_human Caspase-1 Interleukin-1 beta convertase Interleukin-1 beta-converting enzyme p45 CASP1 IL1BC IL1BCE protein protein human Homo sapiens Human MADKVLKEKRKLFIRSMGEGTINGLLDELLQTRVLNKEEMEKVKRENATVMDKTRALIDSVIPKGAQACQICITYICEEDSYLAGTLGLSADQTSGNYLNMQDSQGVLSSFPAPQAVQDNPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVGVSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH DIP protein P29466 original sequence version: 155 DIP protein P29466-1 original sequence version: 169 DIP protein P29466 original sequence version: 169 DIP protein P29466 original sequence version: 163 DIP protein P29466 original sequence version: 101 DIP protein P29466 original sequence version: 160 DIP protein P29466 original sequence version: 184 ABF33CF33CC71584 p58753-2 Toll/interleukin-1 receptor domain-containing adapter protein TIRAP MAL Adaptor protein Wyatt MyD88 adapter-like protein protein protein human Homo sapiens Human MASSTSLPAPGSRPKKPLGKMADWFRQTLLKKPKKRPNSPESTSSDASQPTSQDSPLPPSLSSVTSPSLPPTHASDSGSSRWSKDYDVCVCHSEEDLVAAQDLVSYLEGSTASLRCFLQLRDATPGGAIVSELCQALSSSHCRVLLITPGFLQDPWCKYQMLQALTEAPGAEGCTIPLLSGLSRAAYPPELRFMYYVDGRGPDGGFRQVKEAVMRCKLLQEGEGERDSATVSDLL DIP protein P58753-2 original sequence version: 119 DIP protein P58753-2 original sequence version: 129 383386AA03B70F32 tirap_human Toll/interleukin-1 receptor domain-containing adapter protein MyD88 adapter-like protein Adaptor protein Wyatt TIRAP MAL protein protein human Homo sapiens Human MASSTSLPAPGSRPKKPLGKMADWFRQTLLKKPKKRPNSPESTSSDASQPTSQDSPLPPSLSSVTSPSLPPTHASDSGSSRWSKDYDVCVCHSEEDLVAAQDLVSYLEGSTASLRCFLQLRDATPGGAIVSELCQALSSSHCRVLLITPGFLQDPWCKYQMLQALTEAPGAEGCTIPLLSGLSRAAYPPELRFMYYVDGRGPDGGFRQVKEAVMRYLQTLS DIP protein P58753 original sequence version: 119 44A8454D04704540 tirap-casp1-1 1 7 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 8 unspecified role unspecified role bait bait Region 72-235 Region 72-235 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association casp1-tirap-1 4 9 unspecified role unspecified role prey prey human Homo sapiens Human 7 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association tirap-casp1-2 5 7 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 8 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association casp1-tirap-2 2 7 unspecified role unspecified role bait bait AU1-tag AU1-tag au1 tag au1 tag DTYRYI epitope tag DTYRYI epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 8 unspecified role unspecified role prey prey Region 72-235 Region 72-235 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association tirap-casp1-3 3 7 unspecified role unspecified role prey prey AU1-tag AU1-tag au1 tag au1 tag DTYRYI epitope tag DTYRYI epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 8 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association casp1-tirap-3 6 7 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 8 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association