DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Spiral structure of Escherichia coli HUalphabeta provides foundation for DNA supercoiling. Spiral structure of Escherichia coli HUalphabeta provides foundation for DNA supercoiling. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Guo F., Adhya S. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Guo F., Adhya S. DIP original experiment: DIP-252110X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Spiral structure of Escherichia coli HUalphabeta provides foundation for DNA supercoiling. dbha_ecoli DNA-binding protein HU-alpha hupA b4000 NS2 HU-2 JW3964 protein protein ecoli Escherichia coli (strain K12) MNKTQLIDVIAEKAELSKTQAKAALESTLAAITESLKEGDAVQLVGFGTFKVNHRAERTGRNPQTGKEIKIAAANVPAFVSGKALKDAVK 6B5B8536FDBD13DC dbhb_ecoli DNA-binding protein HU-beta hupB hopD b0440 NS1 HU-1 JW0430 protein protein ecoli Escherichia coli (strain K12) MNKSQLIDKIAAGADISKAAAGRALDAIIASVTESLKEGDDVALVGFGTFAVKERAARTGRNPQTGKEITIAAAKVPSFRAGKALKDAVN DIP protein P0ACF4 original sequence version: 74 DIP protein P0ACF4 original sequence version: 43 C56A3C766D53BB96 hupa-hupb-6 1 3 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 2 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction