DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Relationship between the structure of SET/TAF-Ibeta/INHAT and its histone chaperone activity. Relationship between the structure of SET/TAF-Ibeta/INHAT and its histone chaperone activity. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Muto S., Senda M., Akai Y., Sato L., Suzuki T., Nagai R., Senda T., Horikoshi M. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Muto S., Senda M., Akai Y., Sato L., Suzuki T., Nagai R., Senda T., Horikoshi M. DIP original experiment: DIP-261166X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Relationship between the structure of SET/TAF-Ibeta/INHAT and its histone chaperone activity. q01105-2 Protein SET SET HLA-DR-associated protein II Inhibitor of granzyme A-activated DNase PHAPII Phosphatase 2A inhibitor I2PP2A Template-activating factor I TAF-I beta protein protein human Homo sapiens Human MSAPAAKVSKKELNSNHDGADETSEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLTKRSSQTQNKASRKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYLVPDMDDEEGEGEEDDDDDEEEEGLEDIDEEGDEDEGEEDEDDDEGEEGEEDEGEDD DIP protein Q01105-2 original sequence version: 149 Variant in position: 4:P->Q (in dbSNP:rs1141138). Contains a N6-acetyllysine at position 11. Contains a phosphoserine at position 15. Contains a phosphoserine at position 24. mint 52A6F516686010CE set-1 1 2 unspecified role unspecified role unspecified role unspecified role Region 1-255 Region 1-255 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction