DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Linking pattern formation to cell-type specification: Dichaete and Ind directly repress achaete gene expression in the Drosophila CNS. Linking pattern formation to cell-type specification: Dichaete and Ind directly repress achaete gene expression in the Drosophila CNS. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Zhao G., Boekhoff-Falk G., Wilson BA., Skeath JB. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zhao G., Boekhoff-Falk G., Wilson BA., Skeath JB. DIP original experiment: DIP-261145X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Linking pattern formation to cell-type specification: Dichaete and Ind directly repress achaete gene expression in the Drosophila CNS. Linking pattern formation to cell-type specification: Dichaete and Ind directly repress achaete gene expression in the Drosophila CNS. Linking pattern formation to cell-type specification: Dichaete and Ind directly repress achaete gene expression in the Drosophila CNS. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Zhao G., Boekhoff-Falk G., Wilson BA., Skeath JB. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zhao G., Boekhoff-Falk G., Wilson BA., Skeath JB. DIP original experiment: DIP-261146X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Linking pattern formation to cell-type specification: Dichaete and Ind directly repress achaete gene expression in the Drosophila CNS. Linking pattern formation to cell-type specification: Dichaete and Ind directly repress achaete gene expression in the Drosophila CNS. Linking pattern formation to cell-type specification: Dichaete and Ind directly repress achaete gene expression in the Drosophila CNS. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Zhao G., Boekhoff-Falk G., Wilson BA., Skeath JB. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zhao G., Boekhoff-Falk G., Wilson BA., Skeath JB. DIP original experiment: DIP-261147X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Linking pattern formation to cell-type specification: Dichaete and Ind directly repress achaete gene expression in the Drosophila CNS. Linking pattern formation to cell-type specification: Dichaete and Ind directly repress achaete gene expression in the Drosophila CNS. Linking pattern formation to cell-type specification: Dichaete and Ind directly repress achaete gene expression in the Drosophila CNS. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Zhao G., Boekhoff-Falk G., Wilson BA., Skeath JB. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zhao G., Boekhoff-Falk G., Wilson BA., Skeath JB. DIP original experiment: DIP-261148X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Linking pattern formation to cell-type specification: Dichaete and Ind directly repress achaete gene expression in the Drosophila CNS. vnd_drome Homeobox protein vnd vnd NK2 CG6172 Protein ventral nervous system defective Homeobox protein NK-2 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MTTSASLERTPSKRDRDRERDNSSGLGSAGSLPASPQSAITVSPSSPATPKRPLRTSTPSLERKREREDREDREDRKERQERHERDRDHERFAAVFSTASTTVPTNTSSSSGLAPEQLRIPTGAAAFSGFPGLHSMSSLMLPSSAAVAAAAAAPFLPWSPILLPPWNHALLPAAFYPAALRNALPGLFDAKVPSSQRSGFHISDILNLEGSELKNAAAAAAAAAHHGSDLSHHSASESTSGHRGQGSHTSPSALSPTPAGVSADEHHNGSGTGGGAGEADHHSTTEHHAPPSHPQQQHPHHQQHHHPHLLLPQQHHQQAVAPLPLAHHQSGEAQSHAHANAAAAHLLASHNAAAAAAVAAGQYLPNLPKNFPGSFGDEMSSYHHMAQTMLQHSGRSAWIKENELYGTQQPASPDSTSPVTSEVSYTYIGSNCQTSPALSGDYKSYSRSADSDALSVGDALHTLHGSSGNGSAGGAPTAHALHNNNNNTTNNNNHSLKAEGINGAGSGHDDSLNEDGIEEDIDDVDDADGSGGGDANGSDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHPGLLHGHATHPHHPSALPSPRRVAVPVLVRNGKPCLGDSSKLGADCVSVSSATATAMQNAAAHHLVALNGAAAYQHAAAAAAGLHAHAHAHAHAHGHGHPHAHAQRAAWWP DIP protein P22808 original sequence version: 137 811F20B03A93C95E q6il70_drome CG11551-RA HDC10207 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MVTKWPNTLAQTTLELALRGVEVANQPPEQSLEVYKNRVRAQQPDSFAQSAIVFSSSSRDQLENEIPQKPKMSRSFLMDSLLSDRPNLSQKKEKLGSPGGSPTAAAAVAAAAMLPSIPMLPYPASYVGSYLFSLGIQQQQQQQQQQQQHAAAAAAAAAAAAALQQHPHVSSSPGSLYHPYAQLFASKRKSSGFSNYEGCYPSPPLSANPNSQQLPPIHNLYGSPVVGGLPLPEPGSFCTSPSASSSASLDYTNNFDEPQGKRFKHESSCSPNSSPLKNHSSGGPVEITPLINDYADSSKRIRTAFTSTQLLELEREFSHNAYLSRLRRIEIANRLRLSEKQVKIWFQNRRVKQKKGGSESPTFNLSTNSNGSPQASPVSPQVKVHELKVEA DIP protein Q6IL70 original sequence version: 7 dich_drome SOX domain-containing protein dichaete D fish Sox70D CG5893 Protein fish-hook protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MATLSTHPNYGFHLGQAQGLEDYAPQSQLQLSPGMDMDIKRVLHYSQSLAAMGGSPNGPAGQGVNGSSGMGHHMSSHMTPHHMHQAVSAQQTLSPNSSIGSAGSLGSQSSLGSNGSGLNSSSGHQSAGMHSLATSPGQEGHIKRPMNAFMVWSRLQRRQIAKDNPKMHNSEISKRLGAEWKLLAESEKRPFIDEAKRLRALHMKEHPDYKYRPRRKPKNPLTAGPQGGLQMQAGGMGQQKLGAGPGAGAGGYNPFHQLPPYFAPSHHLDQGYPVPYFGGFDPLALSKLHQSQAAAAAAVNNQGQQQGQAPPQLPPTSLSSFYSGIYSGISAPSLYAAHSANAAGLYPSSSTSSPGSSPGTITPNGMDGSMDSALRRPVPVLY DIP protein Q24533 original sequence version: 119 B03A267F9230A054 d-vnd-1 3 5 unspecified role unspecified role prey prey Region 1-536 Region 1-536 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 7 unspecified role unspecified role bait bait Region 1-141 Region 1-141 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association d-vnd-2 1 5 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 7 unspecified role unspecified role bait bait Region 1-141 Region 1-141 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Region 142-382 Region 142-382 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association d-cg11551_ra-1 4 6 unspecified role unspecified role prey prey Region 296-391 Region 296-391 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Region 1-302 Region 1-302 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 7 unspecified role unspecified role bait bait Region 1-141 Region 1-141 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association d-cg11551_ra-2 2 6 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 7 unspecified role unspecified role bait bait Region 1-141 Region 1-141 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association