DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Cdk5 is involved in BDNF-stimulated dendritic growth in hippocampal neurons. Cdk5 is involved in BDNF-stimulated dendritic growth in hippocampal neurons. PLoS biology 2007 imex curation Cheung ZH., Chin WH., Chen Y., Ng YP., Ip NY. Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Cheung ZH., Chin WH., Chen Y., Ng YP., Ip NY. DIP original experiment: DIP-66710X PLoS biology 2007 IMEx Cdk5 is involved in BDNF-stimulated dendritic growth in hippocampal neurons. Cdk5 is involved in BDNF-stimulated dendritic growth in hippocampal neurons. Cdk5 is involved in BDNF-stimulated dendritic growth in hippocampal neurons. PLoS biology 2007 imex curation Cheung ZH., Chin WH., Chen Y., Ng YP., Ip NY. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Cheung ZH., Chin WH., Chen Y., Ng YP., Ip NY. DIP original experiment: DIP-66712X PLoS biology 2007 IMEx Cdk5 is involved in BDNF-stimulated dendritic growth in hippocampal neurons. Cdk5 is involved in BDNF-stimulated dendritic growth in hippocampal neurons. Cdk5 is involved in BDNF-stimulated dendritic growth in hippocampal neurons. PLoS biology 2007 imex curation Cheung ZH., Chin WH., Chen Y., Ng YP., Ip NY. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Cheung ZH., Chin WH., Chen Y., Ng YP., Ip NY. DIP original experiment: DIP-66717X PLoS biology 2007 IMEx Cdk5 is involved in BDNF-stimulated dendritic growth in hippocampal neurons. Cdk5 is involved in BDNF-stimulated dendritic growth in hippocampal neurons. Cdk5 is involved in BDNF-stimulated dendritic growth in hippocampal neurons. PLoS biology 2007 imex curation Cheung ZH., Chin WH., Chen Y., Ng YP., Ip NY. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Cheung ZH., Chin WH., Chen Y., Ng YP., Ip NY. DIP original experiment: DIP-66705X PLoS biology 2007 IMEx Cdk5 is involved in BDNF-stimulated dendritic growth in hippocampal neurons. Cdk5 is involved in BDNF-stimulated dendritic growth in hippocampal neurons. Cdk5 is involved in BDNF-stimulated dendritic growth in hippocampal neurons. PLoS biology 2007 imex curation Cheung ZH., Chin WH., Chen Y., Ng YP., Ip NY. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Cheung ZH., Chin WH., Chen Y., Ng YP., Ip NY. DIP original experiment: DIP-66706X PLoS biology 2007 IMEx Cdk5 is involved in BDNF-stimulated dendritic growth in hippocampal neurons. Cdk5 is involved in BDNF-stimulated dendritic growth in hippocampal neurons. Cdk5 is involved in BDNF-stimulated dendritic growth in hippocampal neurons. PLoS biology 2007 imex curation Cheung ZH., Chin WH., Chen Y., Ng YP., Ip NY. Only protein-protein interactions rat Rattus norvegicus (Rat) Rat anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Cheung ZH., Chin WH., Chen Y., Ng YP., Ip NY. DIP original experiment: DIP-66708X PLoS biology 2007 IMEx Cdk5 is involved in BDNF-stimulated dendritic growth in hippocampal neurons. Cdk5 is involved in BDNF-stimulated dendritic growth in hippocampal neurons. Cdk5 is involved in BDNF-stimulated dendritic growth in hippocampal neurons. PLoS biology 2007 imex curation Cheung ZH., Chin WH., Chen Y., Ng YP., Ip NY. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay western blot western blot Immuno blot Immuno blot Cheung ZH., Chin WH., Chen Y., Ng YP., Ip NY. DIP original experiment: DIP-66713X PLoS biology 2007 IMEx Cdk5 is involved in BDNF-stimulated dendritic growth in hippocampal neurons. Cdk5 is involved in BDNF-stimulated dendritic growth in hippocampal neurons. Cdk5 is involved in BDNF-stimulated dendritic growth in hippocampal neurons. PLoS biology 2007 imex curation Cheung ZH., Chin WH., Chen Y., Ng YP., Ip NY. Only protein-protein interactions rat Rattus norvegicus (Rat) Rat anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Cheung ZH., Chin WH., Chen Y., Ng YP., Ip NY. DIP original experiment: DIP-66709X PLoS biology 2007 IMEx Cdk5 is involved in BDNF-stimulated dendritic growth in hippocampal neurons. Cdk5 is involved in BDNF-stimulated dendritic growth in hippocampal neurons. Cdk5 is involved in BDNF-stimulated dendritic growth in hippocampal neurons. PLoS biology 2007 imex curation Cheung ZH., Chin WH., Chen Y., Ng YP., Ip NY. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Cheung ZH., Chin WH., Chen Y., Ng YP., Ip NY. DIP original experiment: DIP-66711X PLoS biology 2007 IMEx Cdk5 is involved in BDNF-stimulated dendritic growth in hippocampal neurons. Cdk5 is involved in BDNF-stimulated dendritic growth in hippocampal neurons. Cdk5 is involved in BDNF-stimulated dendritic growth in hippocampal neurons. PLoS biology 2007 imex curation Cheung ZH., Chin WH., Chen Y., Ng YP., Ip NY. Only protein-protein interactions rat Rattus norvegicus (Rat) Rat anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Cheung ZH., Chin WH., Chen Y., Ng YP., Ip NY. DIP original experiment: DIP-66707X PLoS biology 2007 IMEx Cdk5 is involved in BDNF-stimulated dendritic growth in hippocampal neurons. Cdk5 is involved in BDNF-stimulated dendritic growth in hippocampal neurons. Cdk5 is involved in BDNF-stimulated dendritic growth in hippocampal neurons. PLoS biology 2007 imex curation Cheung ZH., Chin WH., Chen Y., Ng YP., Ip NY. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Cheung ZH., Chin WH., Chen Y., Ng YP., Ip NY. DIP original experiment: DIP-66715X PLoS biology 2007 IMEx Cdk5 is involved in BDNF-stimulated dendritic growth in hippocampal neurons. Cdk5 is involved in BDNF-stimulated dendritic growth in hippocampal neurons. Cdk5 is involved in BDNF-stimulated dendritic growth in hippocampal neurons. PLoS biology 2007 imex curation Cheung ZH., Chin WH., Chen Y., Ng YP., Ip NY. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay western blot western blot Immuno blot Immuno blot Cheung ZH., Chin WH., Chen Y., Ng YP., Ip NY. DIP original experiment: DIP-66714X PLoS biology 2007 IMEx Cdk5 is involved in BDNF-stimulated dendritic growth in hippocampal neurons. Cdk5 is involved in BDNF-stimulated dendritic growth in hippocampal neurons. Cdk5 is involved in BDNF-stimulated dendritic growth in hippocampal neurons. PLoS biology 2007 imex curation Cheung ZH., Chin WH., Chen Y., Ng YP., Ip NY. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Cheung ZH., Chin WH., Chen Y., Ng YP., Ip NY. DIP original experiment: DIP-66716X PLoS biology 2007 IMEx Cdk5 is involved in BDNF-stimulated dendritic growth in hippocampal neurons. ntrk2_human BDNF/NT-3 growth factors receptor Tropomyosin-related kinase B NTRK2 TRKB GP145-TrkB Neurotrophic tyrosine kinase receptor type 2 TrkB tyrosine kinase protein protein human Homo sapiens Human MSSWIRWHGPAMARLWGFCWLVVGFWRAAFACPTSCKCSASRIWCSDPSPGIVAFPRLEPNSVDPENITEIFIANQKRLEIINEDDVEAYVGLRNLTIVDSGLKFVAHKAFLKNSNLQHINFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNESSKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMYWDVGNLVSKHMNETSHTQGSLRITNISSDDSGKQISCVAENLVGEDQDSVNLTVHFAPTITFLESPTSDHHWCIPFTVKGNPKPALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYTLIAKNEYGKDEKQISAHFMGWPGIDDGANPNYPDVIYEDYGTAANDIGDTTNRSNEIPSTDVTDKTGREHLSVYAVVVIASVVGFCLLVMLFLLKLARHSKFGMKGPASVISNDDDSASPLHHISNGSNTPSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQLKPDTFVQHIKRHNIVLKRELGEGAFGKVFLAECYNLCPEQDKILVAVKTLKDASDNARKDFHREAELLTNLQHEHIVKFYGVCVEGDPLIMVFEYMKHGDLNKFLRAHGPDAVLMAEGNPPTELTQSQMLHIAQQIAAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYSTDYYRVGGHTMLPIRWMPPESIMYRKFTTESDVWSLGVVLWEIFTYGKQPWYQLSNNEVIECITQGRVLQRPRTCPQEVYELMLGCWQREPHMRKNIKGIHTLLQNLAKASPVYLDILG DIP protein Q16620 original sequence version: 83 DIP protein Q16620 original sequence version: 129 DIP protein Q16620 original sequence version: 151 2FEB9159948F0D13 cdk5_mouse Cyclin-dependent-like kinase 5 Cdk5 Cdkn5 Crk6 CR6 protein kinase Cell division protein kinase 5 Serine/threonine-protein kinase PSSALRE Tau protein kinase II catalytic subunit protein protein mouse Mus musculus Mouse MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPAMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP DIP protein P49615 original sequence version: 65 DIP protein P49615 original sequence version: 103 4CB11CED9017D535 ntrk2_rat BDNF/NT-3 growth factors receptor Ntrk2 Trkb Neurotrophic tyrosine kinase receptor type 2 TrkB tyrosine kinase protein protein rat Rattus norvegicus (Rat) Rat MSPWPRWHGPAMARLWGLCLLVLGFWRASLACPMSCKCSTTRIWCTEPSPGIVAFPRLEPNSIDPENITEILIANQKRLEIINEDDVEAYVGLKNLTIVDSGLKFVAYKAFLKNGNLRHINFTRNKLTSLSRRHFRHLDLSDLILTGNPFTCSCDIMWLKTLQETKSSPDTQDLYCLNESSKNTPLANLQIPNCGLPSARLAAPNLTVEEGKSVTISCSVGGDPLPTLYWDVGNLVSKHMNETSHTQGSLRITNISSDDSGKQISCVAENLVGEDQDSVNLTVHFAPTITFLESPTSDHHWCIPFTVRGNPKPALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYTLMAKNEYGKDERQISAHFMGRPGVDYETNPNYPEVLYEDWTTPTDIGDTTNKSNEIPSTDVADQTNREHLSVYAVVVIASVVGFCLLVMLLLLKLARHSKFGMKGPASVISNDDDSASPLHHISNGSNTPSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQLKPDTFVQHIKRHNIVLKRELGEGAFGKVFLAECYNLCPEQDKILVAVKTLKDASDNARKDFHREAELLTNLQHEHIVKFYGVCVEGDPLIMVFEYMKHGDLNKFLRAHGPDAVLMAEGNPPTELTQSQMLHIAQQIAAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYSTDYYRVGGHTMLPIRWMPPESIMYRKFTTESDVWSLGVVLWEIFTYGKQPWYQLSNNEVIECITQGRVLQRPRTCPQEVYELMLGCWQREPHTRKNIKNIHTLLQNLAKASPVYLDILG DIP protein Q63604 original sequence version: 141 DIP protein Q63604 original sequence version: 69 DIP protein Q63604 original sequence version: 133 DIP protein Q63604 original sequence version: 104 DIP protein Q63604-1 original sequence version: 105 Receptor for brain-derived neurotrophic factor (BDNF), neurotrophin-3 and neurotrophin-4/5 but not nerve growth factor (NGF). Involved in the development and/or maintenance of the nervous system. This is a tyrosine-protein kinase receptor. Known substrates for the TRK receptors are SHC1, PI-3 kinase, and PLC-gamma-1 mint 0DDACDA212CDAA0E cdk5_rat Cyclin-dependent-like kinase 5 Cdk5 Cell division protein kinase 5 Tau protein kinase II catalytic subunit Serine/threonine-protein kinase PSSALRE Cdkn5 protein protein rat Rattus norvegicus (Rat) Rat MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSLLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPAMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP DIP protein Q03114 original sequence version: 60 4CBFF80794F931DF ntrk2_mouse BDNF/NT-3 growth factors receptor Ntrk2 Trkb Neurotrophic tyrosine kinase receptor type 2 TrkB tyrosine kinase GP145-TrkB/GP95-TrkB protein protein mouse Mus musculus Mouse MSPWLKWHGPAMARLWGLCLLVLGFWRASLACPTSCKCSSARIWCTEPSPGIVAFPRLEPNSVDPENITEILIANQKRLEIINEDDVEAYVGLRNLTIVDSGLKFVAYKAFLKNSNLRHINFTRNKLTSLSRRHFRHLDLSDLILTGNPFTCSCDIMWLKTLQETKSSPDTQDLYCLNESSKNMPLANLQIPNCGLPSARLAAPNLTVEEGKSVTLSCSVGGDPLPTLYWDVGNLVSKHMNETSHTQGSLRITNISSDDSGKQISCVAENLVGEDQDSVNLTVHFAPTITFLESPTSDHHWCIPFTVRGNPKPALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYTLMAKNEYGKDERQISAHFMGRPGVDYETNPNYPEVLYEDWTTPTDIGDTTNKSNEIPSTDVADQSNREHLSVYAVVVIASVVGFCLLVMLLLLKLARHSKFGMKGPASVISNDDDSASPLHHISNGSNTPSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQLKPDTFVQHIKRHNIVLKRELGEGAFGKVFLAECYNLCPEQDKILVAVKTLKDASDNARKDFHREAELLTNLQHEHIVKFYGVCVEGDPLIMVFEYMKHGDLNKFLRAHGPDAVLMAEGNPPTELTQSQMLHIAQQIAAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYSTDYYRVGGHTMLPIRWMPPESIMYRKFTTESDVWSLGVVLWEIFTYGKQPWYQLSNNEVIECITQGRVLQRPRTCPQEVYELMLGCWQREPHTRKNIKSIHTLLQNLAKASPVYLDILG DIP protein P15209 original sequence version: 171 DIP protein P15209 original sequence version: 90 DIP protein P15209 original sequence version: 138 DIP protein P15209 original sequence version: 151 50E08D5FF86D8F30 ntrk1_rat High affinity nerve growth factor receptor Neurotrophic tyrosine kinase receptor type 1 p140-TrkA Slow nerve growth factor receptor Ntrk1 Trk Trka protein protein rat Rattus norvegicus (Rat) Rat MLRGQRHGQLGWHRPAAGLGGLVTSLMLACACAASCRETCCPVGPSGLRCTRAGTLNTLRGLRGAGNLTELYVENQRDLQRLEFEDLQGLGELRSLTIVKSGLRFVAPDAFHFTPRLSHLNLSSNALESLSWKTVQGLSLQDLTLSGNPLHCSCALLWLQRWEQEDLCGVYTQKLQGSGSGDQFLPLGHNNSCGVPSVKIQMPNDSVEVGDDVFLQCQVEGQALQQADWILTELEGTATMKKSGDLPSLGLTLVNVTSDLNKKNVTCWAENDVGRAEVSVQVSVSFPASVHLGKAVEQHHWCIPFSVDGQPAPSLRWFFNGSVLNETSFIFTQFLESALTNETMRHGCLRLNQPTHVNNGNYTLLAANPYGQAAASIMAAFMDNPFEFNPEDPIPVSFSPVDTNSTSRDPVEKKDETPFGVSVAVGLAVSAALFLSALLLVLNKCGQRSKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPTEGKGSGLQGHIMENPQYFSDTCVHHIKRQDIILKWELGEGAFGKVFLAECYNLLNDQDKMLVAVKALKETSENARQDFHREAELLTMLQHQHIVRFFGVCTEGGPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLASLHFVHRDLATRNCLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFSTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIECITQGRELERPRACPPDVYAIMRGCWQREPQQRLSMKDVHARLQALAQAPPSYLDVLG DIP protein P35739 original sequence version: 73 DIP protein P35739 original sequence version: 108 D564E8801E8978F8 ntrk3_rat NT-3 growth factor receptor Ntrk3 Trkc Neurotrophic tyrosine kinase receptor type 3 TrkC tyrosine kinase GP145-TrkC protein protein rat Rattus norvegicus (Rat) Rat MDVSLCPAKCSFWRIFLLGSVWLDYVGSVLACPANCVCSKTEINCRRPDDGNLFPLLEGQDSGNSNGNASINITDISRNITSIHIENWRGLHTLNAVDMELYTGLQKLTIKNSGLRNIQPRAFAKNPHLRYINLSSNRLTTLSWQLFQTLSLRELRLEQNFFNCSCDIRWMQLWQEQGEARLDSQSLYCISADGSQLPLFRMNISQCDLPEISVSHVNLTVREGDNAVITCNGSGSPLPDVDWIVTGLQSINTHQTNLNWTNVHAINLTLVNVTSEDNGFTLTCIAENVVGMSNASVALTVYYPPRVVSLVEPEVRLEHCIEFVVRGNPTPTLHWLYNGQPLRESKIIHMDYYQEGEVSEGCLLFNKPTHYNNGNYTLIAKNALGTANQTINGHFLKEPFPESTDFFDFESDASPTPPITVTHKPEEDTFGVSIAVGLAAFACVLLVVLFIMINKYGRRSKFGMKGPVAVISGEEDSASPLHHINHGITTPSSLDAGPDTVVIGMTRIPVIENPQYFRQGHNCHKPDTYVQHIKRRDIVLKRELGEGAFGKVFLAECYNLSPTKDKMLVAVKALKDPTLAARKDFQREAELLTNLQHEHIVKFYGVCGDGDPLIMVFEYMKHGDLNKFLRAHGPDAMILVDGQPRQAKGELGLSQMLHIASQIASGMVYLASQHFVHRDLATRNCLVGANLLVKIGDFGMSRDVYSTDYYREGPYQKGPFSVSWQQQRLAASAASTLFNPSGNDFCIWCEVGGHTMLPIRWMPPESIMYRKFTTESDVWSFGVILWEIFTYGKQPWFQLSNTEVIECITQGRVLERPRVCPKEVYDVMLGCWQREPQQRLNIKEIYKILHALGKATPIYLDILG DIP protein Q03351 original sequence version: 79 DIP protein Q03351 original sequence version: 93 mint Receptor for neurotrophin-3 (NTF3). This is a tyrosine-protein kinase receptor. Known substrates for the TRK receptors are SHC1, PI-3 kinase, and PLCG1. TrkC isoforms containing insertions within the kinase domain can autophosphorylate in response to NT-3, but cannot mediate downstream phenotypic responses A202E993E208F636 cd5r1_rat Cyclin-dependent kinase 5 activator 1 Cdk5r1 Cdk5r Cyclin-dependent kinase 5 regulatory subunit 1 TPKII regulatory subunit protein protein rat Rattus norvegicus (Rat) Rat MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKAQPNSSYQSNIAHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTGVSSSVKKAPHPAITSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR DIP protein P61810 original sequence version: 31 165AA0747410B0C0 cd5r1_mouse Cyclin-dependent kinase 5 activator 1 Cdk5r1 Cdk5r Nck5a Cyclin-dependent kinase 5 regulatory subunit 1 TPKII regulatory subunit protein protein mouse Mus musculus Mouse MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKAQPNSSYQSNIAHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTGVSSSVKKAPHPAITSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR DIP protein P61809 original sequence version: 32 DIP protein P61809 original sequence version: 98 p35 is a neuron specific activator of CDK5. The complex p35/CDK5 is required for neurite outgrowth and cortical lamination. Activator of TPKII mint 165AA0747410B0C0 cdk5-ntrk1-1 4 20 unspecified role unspecified role prey prey human Homo sapiens Human 16 unspecified role unspecified role prey prey human Homo sapiens Human 17 unspecified role unspecified role bait bait human Homo sapiens Human 19 unspecified role unspecified role prey prey human Homo sapiens Human association association cdk5r1-ntrk1-1 5 20 unspecified role unspecified role prey prey human Homo sapiens Human 16 unspecified role unspecified role prey prey human Homo sapiens Human 21 unspecified role unspecified role bait bait human Homo sapiens Human 19 unspecified role unspecified role prey prey human Homo sapiens Human association association cdk5-cdk5r1-6 10 16 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat 21 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat 17 unspecified role unspecified role bait bait rat Rattus norvegicus (Rat) Rat association association cdk5r1-cdk5-5 6 16 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat 21 unspecified role unspecified role bait bait rat Rattus norvegicus (Rat) Rat 17 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat association association ntrk2-cdk5-1 8 16 unspecified role unspecified role bait bait rat Rattus norvegicus (Rat) Rat 21 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat 17 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat association association cdk5-ntrk2-1 1 14 unspecified role unspecified role prey prey human Homo sapiens Human 17 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey direct interaction direct interaction cdk5-cdk5r1-8 9 22 unspecified role unspecified role prey prey mouse Mus musculus Mouse 15 unspecified role unspecified role bait bait mouse Mus musculus Mouse 18 unspecified role unspecified role prey prey mouse Mus musculus Mouse association association cdk5r1-cdk5-6 2 22 unspecified role unspecified role bait bait mouse Mus musculus Mouse 15 unspecified role unspecified role prey prey mouse Mus musculus Mouse 18 unspecified role unspecified role prey prey mouse Mus musculus Mouse association association cdk5-ntrk2-2 7 16 enzyme target enzyme target substrate substrate unspecified role unspecified role chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey 17 enzyme enzyme unspecified role unspecified role rat Rattus norvegicus (Rat) Rat direct interaction direct interaction cdk5-ntrk3-1 12 20 enzyme target enzyme target substrate substrate unspecified role unspecified role chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey 17 enzyme enzyme unspecified role unspecified role rat Rattus norvegicus (Rat) Rat direct interaction direct interaction cdk5-ntrk2-3 11 16 enzyme target enzyme target substrate substrate unspecified role unspecified role Q63604:p.Ser478Ala S478A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A This feature has been corrected as a result of our quality control procedures. The original label was 'S478A'. Wed May 02 15:59:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser478ala' Tue Jun 30 17:11:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser478Ala' Q63604:p.Thr489Ala T489A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T A This feature has been corrected as a result of our quality control procedures. The original label was 'T489A'. Wed May 02 18:29:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr489ala' Tue Jun 30 15:37:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr489Ala' ecolx Escherichia coli 17 enzyme enzyme unspecified role unspecified role rat Rattus norvegicus (Rat) Rat direct interaction direct interaction cdk5-ntrk2-4 13 14 enzyme target enzyme target substrate substrate unspecified role unspecified role Kinase domain 455-822 Kinase domain 455-822 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 17 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction cdk5-ntrk2-5 3 14 enzyme enzyme unspecified role unspecified role Kinase domain 455-822 Kinase domain 455-822 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 17 enzyme target enzyme target substrate substrate unspecified role unspecified role pTyrosine 15 pTyrosine 15 optyr O4'-phospho-L-tyrosine (2S)-2-amino-3-(4-phosphonooxyphenyl)propanoic acid 2-azanyl-3-(4-phosphonooxyphenyl)propanoic acid MOD_RES Phosphotyrosine O4-phosphotyrosine tyrosine phosphate 2-amino-3-(4-hydroxyphenyl)propanoic acid 4'-phosphate O4'-phospho-L-tyrosine O4'-phosphorylated L-tyrosine OPTyr Phospho Phospho Tyrosinyl Phosphorylation phosphorylationy certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction