DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Drosophila TCTP is essential for growth and proliferation through regulation of dRheb GTPase. Drosophila TCTP is essential for growth and proliferation through regulation of dRheb GTPase. Nature 2007 imex curation Hsu YC., Chern JJ., Cai Y., Liu M., Choi KW. Only protein-protein interactions in vitro In vitro gdp_gtp exchange gdp/gtp exchange assay gtp/gdp exchange guanine nucleotide exchange assay gtp/gdp exchange guanine nucleotide exchange assay gdp_gtp exchange predetermined predetermined participant predetermined Hsu YC., Chern JJ., Cai Y., Liu M., Choi KW. DIP original experiment: DIP-253261X Nature 2007 IMEx Drosophila TCTP is essential for growth and proliferation through regulation of dRheb GTPase. Drosophila TCTP is essential for growth and proliferation through regulation of dRheb GTPase. Drosophila TCTP is essential for growth and proliferation through regulation of dRheb GTPase. Nature 2007 imex curation Hsu YC., Chern JJ., Cai Y., Liu M., Choi KW. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Hsu YC., Chern JJ., Cai Y., Liu M., Choi KW. DIP original experiment: DIP-253259X Nature 2007 IMEx Drosophila TCTP is essential for growth and proliferation through regulation of dRheb GTPase. Drosophila TCTP is essential for growth and proliferation through regulation of dRheb GTPase. Drosophila TCTP is essential for growth and proliferation through regulation of dRheb GTPase. Nature 2007 imex curation Hsu YC., Chern JJ., Cai Y., Liu M., Choi KW. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Hsu YC., Chern JJ., Cai Y., Liu M., Choi KW. DIP original experiment: DIP-253258X Nature 2007 IMEx Drosophila TCTP is essential for growth and proliferation through regulation of dRheb GTPase. Drosophila TCTP is essential for growth and proliferation through regulation of dRheb GTPase. Drosophila TCTP is essential for growth and proliferation through regulation of dRheb GTPase. Nature 2007 imex curation Hsu YC., Chern JJ., Cai Y., Liu M., Choi KW. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Hsu YC., Chern JJ., Cai Y., Liu M., Choi KW. DIP original experiment: DIP-253257X Nature 2007 IMEx Drosophila TCTP is essential for growth and proliferation through regulation of dRheb GTPase. Drosophila TCTP is essential for growth and proliferation through regulation of dRheb GTPase. Drosophila TCTP is essential for growth and proliferation through regulation of dRheb GTPase. Nature 2007 imex curation Hsu YC., Chern JJ., Cai Y., Liu M., Choi KW. Only protein-protein interactions in vitro In vitro gdp_gtp exchange gdp/gtp exchange assay gtp/gdp exchange guanine nucleotide exchange assay gtp/gdp exchange guanine nucleotide exchange assay gdp_gtp exchange predetermined predetermined participant predetermined Hsu YC., Chern JJ., Cai Y., Liu M., Choi KW. DIP original experiment: DIP-253260X Nature 2007 IMEx Drosophila TCTP is essential for growth and proliferation through regulation of dRheb GTPase. tctp_human Translationally-controlled tumor protein TPT1 p23 Histamine-releasing factor Fortilin protein protein human Homo sapiens Human MIIYRDLISHDEMFSDIYKIREIADGLCLEVEGKMVSRTEGNIDDSLIGGNASAEGPEGEGTESTVITGVDIVMNHHLQETSFTKEAYKKYIKDYMKSIKGKLEEQRPERVKPFMTGAAEQIKHILANFKNYQFFIGENMNPDGMVALLDYREDGVTPYMIFFKDGLEMEKC DIP protein P13693 original sequence version: 147 BD31399B71CA62F9 rheb_drome GTP-binding protein Rheb homolog Rheb CG1081 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MPTKERHIAMMGYRSVGKSSLCIQFVEGQFVDSYDPTIENTFTKIERVKSQDYIVKLIDTAGQDEYSIFPVQYSMDYHGYVLVYSITSQKSFEVVKIIYEKLLDVMGKKYVPVVLVGNKIDLHQERTVSTEEGKKLAESWRAAFLETSAKQNESVGDIFHQLLILIENENGNPQEKSGCLVS DIP protein Q9VND8 original sequence version: 102 CAB8AE2A988A0179 tctp_drome Translationally-controlled tumor protein homolog CG4800 Tctp protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MKIYKDIITGDEMFADTYKMKLVDDVIYEVYGKLITRQGDDIKLEGANASAEEADEGTDITSESGVDVVLNHRLTECFAFGDKKSYTLYLKDYMKKVLAKLEEKSPDQVDIFKTNMNKAMKDILGRFKELQFFTGESMDCDGMVALVEYREINGDSVPVLMFFKHGLEEEKC DIP protein Q9VGS2 original sequence version: 90 8EA92FE8D37FC979 rheb_human GTP-binding protein Rheb Ras homolog enriched in brain RHEB RHEB2 protein protein human Homo sapiens Human MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVDTAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNKKDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEKMDGAASQGKSSCSVM DIP protein Q15382 original sequence version: 146 DIP protein Q15382 original sequence version: 91 8F4C8080BDF928FD rheb-tctp-1 4 7 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 8 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association tpt1-rheb-1 2 6 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 9 unspecified role unspecified role prey prey MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction rheb-tpt1-1 1 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction tctp-rheb-1 3 7 unspecified role unspecified role prey prey MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 8 unspecified role unspecified role bait bait Q9VGS2:p.Glu12Val E12V mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain E V This feature has been corrected as a result of our quality control procedures. The original label was 'E12V'. Wed May 02 20:00:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu12val' Tue Jun 30 17:10:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu12Val' GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction rheb-tctp-2 5 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 8 unspecified role unspecified role unspecified role unspecified role Q9VGS2:p.Glu12Val E12V mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain E V This feature has been corrected as a result of our quality control procedures. The original label was 'E12V'. Wed May 02 19:17:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu12val' Tue Jun 30 18:33:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu12Val' ecolx Escherichia coli direct interaction direct interaction